Рак в рожденный в год змеи: Раки в год Змеи — характеристика мужчин и женщин

Раки в год Змеи — характеристика мужчин и женщин

Гороскопические Раки, рожденные в год Змеи, ценят постоянство, безопасность и материальную обеспеченность. Для окружающих их характер полон тайн и загадок. Люди, сочетающие в гороскопе знаки Рак и Змея, не пускают в свой мирок никого. Они редко доверяют даже самым близким, стараясь контролировать собственные действия с расчетливостью и хладнокровием.

Люди Раки-Змеи лучше будут проводить время одни, наедине со своими мыслями: это позволяет им восстановить силы, стойко переносить невзгоды и не впадать в панику

Умение анализировать поступки возводит их в ранг экспертов по распознаванию настроения и эмоций окружающих. Раки-Змеи очень тонко понимают чувства и действия людей, давая поступкам логическое объяснение.

Характер Раков-Змей полон тайн и загадок


Характеристика мужчин Раков-Змей

Внешне парень Рак в год Змеи редко проявляет свои эмоции и чувства. Немногие могут видеть моменты, когда он взволнован или обеспокоен чем-либо. Оба знака западного и восточного гороскопа: Рак и Змея дают своему обладателю сильное желание стабильности и безопасности. Он лучше будет проводить свои выходные дома, где можно отдохнуть от суеты. Мужчина Рак-Змея только в исключительных случаях отправляется на поиски приключений. Со стороны может показаться, что это гордый одиночка.

Если возникают проблемы, гороскопический Рак-Змея мужского пола будет в одиночестве обдумывать возможные варианты выхода. В этот период лучше оставить его в покое, так как ничего конкретного в такой момент получить от него нельзя.

Более того, если пытаться вытянуть парня Рака-Змею из его кокона, можно нарваться на агрессию

Имея упрямый характер, мужчина Рак, рожденный в год Змеи, игнорирует советы других. Он не любит, когда вмешиваются в его жизнь, хотя при этом может понимать, что советы идут от людей, которые искренни в своих желаниях помочь.

Мужчина по гороскопу Рак, рожденный в год Змеи, трудно переносит неудачи. Он тяжело выходит из состояния депрессии, поэтому старается предотвратить всякие предпосылки для этого. Только в компании надежных, серьезных людей он становится активными и готов на многое.

Мужчины Раки, рожденные в год Змеи, обладают большой энергией и направляют ее на создание карьеры. В работе они стараются окружить себя серьезными людьми, с которыми можно воплощать смелые идеи. Целеустремленность позволяет им добиться всего, что нужно в своей сфере деятельности.

Мужчина Рак в год Змеи упрям и никогда не попросит совет

В карьере мужчина Рак-Змея медленно поднимается к вершине успеха. Он предпочитает постепенно продвигаться, но быть уверенным в каждом шаге. Рак, рожденный в год Змеи, редко предается мечтам. Скорее он реалист, который делает только то, в чем надеется получить результат.

В любовной сфере мужчина Рак-Змея очень успешен. Он оценивает свою «жертву» безошибочно и привязывает настолько, чтобы полностью подчинить себе

Девушке редко можно дождаться от него активности. Скорее всего, он будет выжидать, а при конфликтах отходить. Но если он решил завоевать какую-то особу, вряд ли ей удастся избежать цепких оков Рака-Змеи. Он окружает ее заботой и вниманием настолько, что через небольшое время девушка понимает, что не может жить без своего кавалера. Стоит отметить, что парень Рак (в год Змеи) также становится зависим от избранницы. В брачном союзе Рак-Змея и его супруга представляют единое целое.

Недостатки знака

Большая слабость у мужчин гороскопических Раков-Змей – склонность к замкнутости и одиночеству. Они привыкли полагаться на себя и редко слушают советы даже близких людей. Из-за болезненного отношения к неудачам они стараются не идти на риск и поэтому часто упускают возможные шансы на успех в карьере и финансах.

Из-за страха рисковать Раки-Змеи часто упускают хорошие возможности

Характеристика женщин Раков-Змей

Девушка Рак, рожденная в год Змеи, обладает особым видением мира. У нее в голове рождаются невероятные фантазии, которые она боится высказать из-за своей стеснительности. Женщина по гороскопу Рак-Змея хорошо может реализовать себя в творчестве: талант, удача и практические черты характера помогают добиться очень много представительницам этих знаков. Они никогда не откажутся от шансов судьбы, что позволяет реализовать себя в полной мере.

Женщины Раки-Змеи имеют сложный характер, который не становится препятствием на пути к достижениям в карьере. Они постепенно идут к цели и добиваются своего. Гороскопические Змеи-Раки малую роль отводят финансовой стороне жизни. Для них значимость представляет возможность реализоваться как личности.

В любви женщины по гороскопу Раки-Змеи редко успешны в юном возрасте. Они понимают, как следует правильно вести себя в паре, но на практике воплощают это не всегда. В зрелом возрасте женщины Раки-Змеи способны выстроить отношения, так как умеют выбирать того, кто соответствует их идеалам.

В семейной жизни гороскопическая Змея-Рак становится главной скрипкой. Она видит, чего желают другие, и умеет это дать

Женщины этих двух знаков – великолепные хозяйки, которые становятся центром домашнего очага. Они готовят, убирают, благоустраивают свое жилье, создавая уютную атмосферу в своем доме. Важно, что для нее не имеет значения, будет она главой в семье или будет «за мужем». Главное – ее внутренний мир. Если там гармония, Рак-Змея сумеет создать благоприятную ауру в отношениях и сохранит взаимопонимание между членами семьи.

Женщины Раки-Змеи – прекрасные хозяйки!

Недостатки знака

Главный минус женщины гороскопа Рак-Змея – внутреннее отдаление от окружающих. Она слишком уходит в себя, что мешает в продвижении по карьерной лестнице. Раки-Змеи имеют не слабый полет фантазии. Он часто уводит из реальности и не дает выбирать выполнимые проекты, тормозя на пути построения удачной жизни. Еще ей следует научиться доносить свои мысли до других людей. Понимание собеседника и умение разделять его взгляды позволит добиться всего, что необходимо для счастья.

Любовная совместимость Рака в год Змеи

У Раков-Змей отличная совместимость в любви с теми, кто уже готов на серьезные отношения. Для мужчины этих двух знаков подходит женщина, которая способна полностью раствориться в нем и не будет мыслить о своем существовании без него.

Женщине по гороскопу Рак, родившейся в год Змеи, будут подходить мужчины, которые умеют возлагать на себя заботы о семье

По восточному гороскопу хорошая совместимость возникает с противоположным полом, рожденным в год Обезьяны, Быка, Петуха, Дракона. Постараться для поддержания гармонии придется с людьми, рожденными в год Лошади, Змеи, Кролика, Тигра, Козы, Крысы, Собаки. Неудачная совместимость, по мнению астрологов, с теми, кто рожден в год Кабана.

Из западного гороскопического ряда у Раков благополучно складываются отношения в любви и семейной жизни со Скорпионами, Тельцами, Козерогами и Весами. В качестве сотрудника по работе лучшая партнерша или партнер будут Водолеи и Львы.

Минимальная совместимость
По восточному календарюОбезьяна, Бык, Петух, ДраконЛошадь, Змея, Кот, Тигр, Коза, Крыса, СобакаСвинья
По западному календарюСкорпион, Телец, Козерог, ВесыВодолей, Лев, Дева, Рыбы, РакБлизнецы, Стрелец, Овен

Полная характеристика ребенка Рака, рожденного в год Змеи

Дети, рожденные в год Змеи, обладают упорством, мудростью и настойчивостью. Они очень заботливые и любознательные. Причем, появившиеся в период действия в астрологическом поле созвездия Рак, еще и дружелюбны. Их друзья всегда рассказывают им свои тайны, ведь на них можно положиться.

Мальчик Рак в год Змеи обладает мощным обаянием. Благодаря общительности и большому количеству друзей, в нужный момент он сумеет достать необходимую информацию и применит ее в своих целях.

Девочка Рак, рожденная в год Змеи, имеет доверительные связи с мамой. Она растет сентиментальным ребенком, который считает своих родных собственностью. Даже во взрослой жизни Рак-Змея будет на первое место ставить заботу о близких.

Девочка Рак-Змея и мама – лучшие подружки

изменяют ли девушки и какой мужчина им нужен, совместимость в любви с другими знаками

Женщина, рожденная в год Змеи под знаком зодиака Рак, обладает проницательными способностями. Она умеет слушать других и ориентироваться на эмоциональное состояние людей. Но сама дама не отличается открытостью и в свой внутренний мир впускает очень ограниченный круг друзей.

Характеристика по гороскопу

Женщина Рак-Змея обладает большой жизненной силой и предусмотрительностью. Она ценит личное пространство и не терпит постороннего вмешательства в частную жизнь. Характеристика девушки позволяет ей быть отличным другом, который даже в сложные моменты останется рядом.

Эта личность обладает творческими способностями. Благодаря интуитивному чутью и целеустремленности такая дама всегда добивается больших успехов.

Она умеет считывать чужие чувства и способна быть хорошей актрисой тогда, когда это может принести выгоду.

Девушка Рак-Змея достаточно коммуникабельна, а потому всегда имеет широкий круг друзей и знакомых. Она очень ответственна и активна, но закрытый характер порой мешает ей, как личности, раскрыться в полной мере.

Такие женщины непонятны для окружающих, так как постоянно витают в облаках. Как результат, в окружении дам находятся люди, схожие по характеру и видению мира. Они могут реализовать себя в творчестве, выразив в искусстве свои мысли и эмоции. Огромный потенциал позволяет Раку-Змее улавливать удачные моменты, что в итоге позволяет личности добиться успеха.

Отличительной чертой характера такой женщины является способность оставаться хладнокровной в любых ситуациях. Она не поддается панике и не выставляет на всеобщее обозрение собственные чувства. Такие люди не умеют работать в команде и могут доверять только самим себе.

Внешне дама излучает обаяние и уверенность, но внутри остается ранимым и чувствительным человеком. Она любит узнавать новое, а потому много времени уделяет самообразованию.

Отношение к дружбе

Женщина Рак-Змея всегда окружена людьми, так как обладает способностью чувствовать чужое настроение. Но к друзьям она предъявляет высокие требования. Дама полностью контролирует жизнь друзей и хочет участвовать во всем, что их касается. Такая личность любит давать советы, которые, в большинстве случаев, никому не нужны.

Представительница этих знаков сильно привязывается к людям, что неизбежно приводит к разочарованиям.

Ее излишняя напористость пугает окружающих, и, со временем, они могут отстраниться от слишком навязчивого друга.

Несмотря на желание контролировать жизнь друзей, девушка Рак-Змея является надежным и верным человеком. Она не способна на подлость и никогда не станет говорить гадости за спиной. Если даму что-то не устраивает, то она всегда выскажет свою точку зрения.

Семья и брак

В семейных отношениях женщина Рак-Змея старается занять лидирующее положение, чтобы иметь возможность контролировать все процессы, происходящие внутри семьи.

Если же дома есть человек с более сильным характером, то она легко может уступить главенство. Для таких людей главное, чтобы в семье царил покой и порядок.

Девушка Змея-Рак практически всегда находится в собственном мире и может не реагировать на внешние процессы. Но если кому-то из членов семьи понадобится помощь или поддержка, она приложит все усилия для нормализации ситуации.

Для построения семьи такой человек выбирает надежного и спокойного спутника. В случае необходимости дама может притвориться слабой и мягкой, чтобы избранник почувствовал себя главой семьи.

Для своих детей женщина не жалеет сил и времени. Для нее важно финансово обеспечить семью, чтобы никто из домочадцев ни в чем не нуждался. Такая личность полностью отдается заботе о семейном гнездышке и всегда самостоятельно принимает важные решения.

Совместимость в любви

Девушка Змея-Рак не знает всех романтических тонкостей и не умеет правильно выстраивать любовные отношения. Неудачные попытки понравиться противоположному полу неизбежно приводят к разочарованию. Поэтому серьезные отношения у таких женщин складываются в более зрелом возрасте.

Для отношений такие девушки ищут спокойных, серьезных, амбициозных и финансово обеспеченных мужчин, которые знают, чего хотят от жизни.

Для них важно, чтобы избранник ценил семейные узы и любил детей. На место ее будущего супруга подходит мужчина, полностью соответствующий этим строгим требованиям.

Женщина Змея-Рак всегда остается верна своему избраннику. Она может стать идеальной женой и подругой, если партнер смирится с непростым характером дамы. Такие женщины изменяют только тогда, когда перестают чувствовать любовь супруга. Поэтому мужчина должен всегда проявлять заботу в адрес второй половинки.

Представительнице этого гороскопа нужен мужчина, рожденный в год Дракона или Петуха. Что касается знака Зодиака, то наибольшей совместимостью она обладает с Тельцом, Скорпионом и Рыбами.

Она так же может гармонично сосуществовать с такими знаками, как Бык-Телец, Тигр-Рыбы, Кот-Скорпион и Собака-Рыбы. С другими мужчинами совместимость не такая хорошая, так как требует от обоих партнеров решения множества межличностных проблем.

Отношение к работе

Женщина Рак-Змея обладает напористостью и целеустремленностью, что помогает ей добиваться карьерных высот. Такая дама умеет правильно организовать свои способности, чтобы постепенно добиться желаемой цели.

Ей всегда сопутствует удача, позволяющая достичь финансового благополучия. И хотя деньги для таких людей играют второстепенную роль, вокруг них всегда находятся возможности, которые позволяют получить хорошее финансовое вознаграждение.

Подробнее узнать о данной личности вы сможете в этом видео.

изменяют ли девушки и какой мужчина им нужен, совместимость в любви с другими знаками

Женщина, рожденная в год Змеи под знаком зодиака Рак, обладает проницательными способностями. Она умеет слушать других и ориентироваться на эмоциональное состояние людей. Но сама дама не отличается открытостью и в свой внутренний мир впускает очень ограниченный круг друзей.

Характеристика по гороскопу

Женщина Рак-Змея обладает большой жизненной силой и предусмотрительностью. Она ценит личное пространство и не терпит постороннего вмешательства в частную жизнь. Характеристика девушки позволяет ей быть отличным другом, который даже в сложные моменты останется рядом.

Эта личность обладает творческими способностями. Благодаря интуитивному чутью и целеустремленности такая дама всегда добивается больших успехов.

Она умеет считывать чужие чувства и способна быть хорошей актрисой тогда, когда это может принести выгоду.

Девушка Рак-Змея достаточно коммуникабельна, а потому всегда имеет широкий круг друзей и знакомых. Она очень ответственна и активна, но закрытый характер порой мешает ей, как личности, раскрыться в полной мере.

Такие женщины непонятны для окружающих, так как постоянно витают в облаках. Как результат, в окружении дам находятся люди, схожие по характеру и видению мира. Они могут реализовать себя в творчестве, выразив в искусстве свои мысли и эмоции. Огромный потенциал позволяет Раку-Змее улавливать удачные моменты, что в итоге позволяет личности добиться успеха.

Отличительной чертой характера такой женщины является способность оставаться хладнокровной в любых ситуациях. Она не поддается панике и не выставляет на всеобщее обозрение собственные чувства. Такие люди не умеют работать в команде и могут доверять только самим себе.

Внешне дама излучает обаяние и уверенность, но внутри остается ранимым и чувствительным человеком.

Она любит узнавать новое, а потому много времени уделяет самообразованию.

Отношение к дружбе

Женщина Рак-Змея всегда окружена людьми, так как обладает способностью чувствовать чужое настроение. Но к друзьям она предъявляет высокие требования. Дама полностью контролирует жизнь друзей и хочет участвовать во всем, что их касается. Такая личность любит давать советы, которые, в большинстве случаев, никому не нужны.

Представительница этих знаков сильно привязывается к людям, что неизбежно приводит к разочарованиям.

Ее излишняя напористость пугает окружающих, и, со временем, они могут отстраниться от слишком навязчивого друга.

Несмотря на желание контролировать жизнь друзей, девушка Рак-Змея является надежным и верным человеком. Она не способна на подлость и никогда не станет говорить гадости за спиной. Если даму что-то не устраивает, то она всегда выскажет свою точку зрения.

Семья и брак

В семейных отношениях женщина Рак-Змея старается занять лидирующее положение, чтобы иметь возможность контролировать все процессы, происходящие внутри семьи. Если же дома есть человек с более сильным характером, то она легко может уступить главенство. Для таких людей главное, чтобы в семье царил покой и порядок.

Девушка Змея-Рак практически всегда находится в собственном мире и может не реагировать на внешние процессы. Но если кому-то из членов семьи понадобится помощь или поддержка, она приложит все усилия для нормализации ситуации.

Для построения семьи такой человек выбирает надежного и спокойного спутника. В случае необходимости дама может притвориться слабой и мягкой, чтобы избранник почувствовал себя главой семьи.

Для своих детей женщина не жалеет сил и времени. Для нее важно финансово обеспечить семью, чтобы никто из домочадцев ни в чем не нуждался. Такая личность полностью отдается заботе о семейном гнездышке и всегда самостоятельно принимает важные решения.

Совместимость в любви

Девушка Змея-Рак не знает всех романтических тонкостей и не умеет правильно выстраивать любовные отношения. Неудачные попытки понравиться противоположному полу неизбежно приводят к разочарованию. Поэтому серьезные отношения у таких женщин складываются в более зрелом возрасте.

Для отношений такие девушки ищут спокойных, серьезных, амбициозных и финансово обеспеченных мужчин, которые знают, чего хотят от жизни.

Для них важно, чтобы избранник ценил семейные узы и любил детей. На место ее будущего супруга подходит мужчина, полностью соответствующий этим строгим требованиям.

Женщина Змея-Рак всегда остается верна своему избраннику. Она может стать идеальной женой и подругой, если партнер смирится с непростым характером дамы. Такие женщины изменяют только тогда, когда перестают чувствовать любовь супруга. Поэтому мужчина должен всегда проявлять заботу в адрес второй половинки.

Представительнице этого гороскопа нужен мужчина, рожденный в год Дракона или Петуха. Что касается знака Зодиака, то наибольшей совместимостью она обладает с Тельцом, Скорпионом и Рыбами.

Она так же может гармонично сосуществовать с такими знаками, как Бык-Телец, Тигр-Рыбы, Кот-Скорпион и Собака-Рыбы. С другими мужчинами совместимость не такая хорошая, так как требует от обоих партнеров решения множества межличностных проблем.

Отношение к работе

Женщина Рак-Змея обладает напористостью и целеустремленностью, что помогает ей добиваться карьерных высот. Такая дама умеет правильно организовать свои способности, чтобы постепенно добиться желаемой цели.

Ей всегда сопутствует удача, позволяющая достичь финансового благополучия. И хотя деньги для таких людей играют второстепенную роль, вокруг них всегда находятся возможности, которые позволяют получить хорошее финансовое вознаграждение.

Подробнее узнать о данной личности вы сможете в этом видео.

изменяют ли девушки и какой мужчина им нужен, совместимость в любви с другими знаками

Женщина, рожденная в год Змеи под знаком зодиака Рак, обладает проницательными способностями. Она умеет слушать других и ориентироваться на эмоциональное состояние людей. Но сама дама не отличается открытостью и в свой внутренний мир впускает очень ограниченный круг друзей.

Характеристика по гороскопу

Женщина Рак-Змея обладает большой жизненной силой и предусмотрительностью. Она ценит личное пространство и не терпит постороннего вмешательства в частную жизнь. Характеристика девушки позволяет ей быть отличным другом, который даже в сложные моменты останется рядом.

Эта личность обладает творческими способностями. Благодаря интуитивному чутью и целеустремленности такая дама всегда добивается больших успехов.

Она умеет считывать чужие чувства и способна быть хорошей актрисой тогда, когда это может принести выгоду.

Девушка Рак-Змея достаточно коммуникабельна, а потому всегда имеет широкий круг друзей и знакомых. Она очень ответственна и активна, но закрытый характер порой мешает ей, как личности, раскрыться в полной мере.

Такие женщины непонятны для окружающих, так как постоянно витают в облаках. Как результат, в окружении дам находятся люди, схожие по характеру и видению мира. Они могут реализовать себя в творчестве, выразив в искусстве свои мысли и эмоции. Огромный потенциал позволяет Раку-Змее улавливать удачные моменты, что в итоге позволяет личности добиться успеха.

Отличительной чертой характера такой женщины является способность оставаться хладнокровной в любых ситуациях. Она не поддается панике и не выставляет на всеобщее обозрение собственные чувства. Такие люди не умеют работать в команде и могут доверять только самим себе.

Внешне дама излучает обаяние и уверенность, но внутри остается ранимым и чувствительным человеком. Она любит узнавать новое, а потому много времени уделяет самообразованию.

Отношение к дружбе

Женщина Рак-Змея всегда окружена людьми, так как обладает способностью чувствовать чужое настроение. Но к друзьям она предъявляет высокие требования. Дама полностью контролирует жизнь друзей и хочет участвовать во всем, что их касается. Такая личность любит давать советы, которые, в большинстве случаев, никому не нужны.

Представительница этих знаков сильно привязывается к людям, что неизбежно приводит к разочарованиям.

Ее излишняя напористость пугает окружающих, и, со временем, они могут отстраниться от слишком навязчивого друга.

Несмотря на желание контролировать жизнь друзей, девушка Рак-Змея является надежным и верным человеком. Она не способна на подлость и никогда не станет говорить гадости за спиной. Если даму что-то не устраивает, то она всегда выскажет свою точку зрения.

Семья и брак

В семейных отношениях женщина Рак-Змея старается занять лидирующее положение, чтобы иметь возможность контролировать все процессы, происходящие внутри семьи. Если же дома есть человек с более сильным характером, то она легко может уступить главенство. Для таких людей главное, чтобы в семье царил покой и порядок.

Девушка Змея-Рак практически всегда находится в собственном мире и может не реагировать на внешние процессы. Но если кому-то из членов семьи понадобится помощь или поддержка, она приложит все усилия для нормализации ситуации.

Для построения семьи такой человек выбирает надежного и спокойного спутника. В случае необходимости дама может притвориться слабой и мягкой, чтобы избранник почувствовал себя главой семьи.

Для своих детей женщина не жалеет сил и времени. Для нее важно финансово обеспечить семью, чтобы никто из домочадцев ни в чем не нуждался. Такая личность полностью отдается заботе о семейном гнездышке и всегда самостоятельно принимает важные решения.

Совместимость в любви

Девушка Змея-Рак не знает всех романтических тонкостей и не умеет правильно выстраивать любовные отношения. Неудачные попытки понравиться противоположному полу неизбежно приводят к разочарованию. Поэтому серьезные отношения у таких женщин складываются в более зрелом возрасте.

Для отношений такие девушки ищут спокойных, серьезных, амбициозных и финансово обеспеченных мужчин, которые знают, чего хотят от жизни.

Для них важно, чтобы избранник ценил семейные узы и любил детей. На место ее будущего супруга подходит мужчина, полностью соответствующий этим строгим требованиям.

Женщина Змея-Рак всегда остается верна своему избраннику. Она может стать идеальной женой и подругой, если партнер смирится с непростым характером дамы. Такие женщины изменяют только тогда, когда перестают чувствовать любовь супруга. Поэтому мужчина должен всегда проявлять заботу в адрес второй половинки.

Представительнице этого гороскопа нужен мужчина, рожденный в год Дракона или Петуха. Что касается знака Зодиака, то наибольшей совместимостью она обладает с Тельцом, Скорпионом и Рыбами.

Она так же может гармонично сосуществовать с такими знаками, как Бык-Телец, Тигр-Рыбы, Кот-Скорпион и Собака-Рыбы. С другими мужчинами совместимость не такая хорошая, так как требует от обоих партнеров решения множества межличностных проблем.

Отношение к работе

Женщина Рак-Змея обладает напористостью и целеустремленностью, что помогает ей добиваться карьерных высот. Такая дама умеет правильно организовать свои способности, чтобы постепенно добиться желаемой цели.

Ей всегда сопутствует удача, позволяющая достичь финансового благополучия. И хотя деньги для таких людей играют второстепенную роль, вокруг них всегда находятся возможности, которые позволяют получить хорошее финансовое вознаграждение.

Подробнее узнать о данной личности вы сможете в этом видео.

изменяют ли девушки и какой мужчина им нужен, совместимость в любви с другими знаками

Женщина, рожденная в год Змеи под знаком зодиака Рак, обладает проницательными способностями. Она умеет слушать других и ориентироваться на эмоциональное состояние людей. Но сама дама не отличается открытостью и в свой внутренний мир впускает очень ограниченный круг друзей.

Характеристика по гороскопу

Женщина Рак-Змея обладает большой жизненной силой и предусмотрительностью. Она ценит личное пространство и не терпит постороннего вмешательства в частную жизнь. Характеристика девушки позволяет ей быть отличным другом, который даже в сложные моменты останется рядом.

Эта личность обладает творческими способностями. Благодаря интуитивному чутью и целеустремленности такая дама всегда добивается больших успехов.

Она умеет считывать чужие чувства и способна быть хорошей актрисой тогда, когда это может принести выгоду.

Девушка Рак-Змея достаточно коммуникабельна, а потому всегда имеет широкий круг друзей и знакомых. Она очень ответственна и активна, но закрытый характер порой мешает ей, как личности, раскрыться в полной мере.

Такие женщины непонятны для окружающих, так как постоянно витают в облаках. Как результат, в окружении дам находятся люди, схожие по характеру и видению мира. Они могут реализовать себя в творчестве, выразив в искусстве свои мысли и эмоции. Огромный потенциал позволяет Раку-Змее улавливать удачные моменты, что в итоге позволяет личности добиться успеха.

Отличительной чертой характера такой женщины является способность оставаться хладнокровной в любых ситуациях. Она не поддается панике и не выставляет на всеобщее обозрение собственные чувства. Такие люди не умеют работать в команде и могут доверять только самим себе.

Внешне дама излучает обаяние и уверенность, но внутри остается ранимым и чувствительным человеком. Она любит узнавать новое, а потому много времени уделяет самообразованию.

Отношение к дружбе

Женщина Рак-Змея всегда окружена людьми, так как обладает способностью чувствовать чужое настроение. Но к друзьям она предъявляет высокие требования. Дама полностью контролирует жизнь друзей и хочет участвовать во всем, что их касается. Такая личность любит давать советы, которые, в большинстве случаев, никому не нужны.

Представительница этих знаков сильно привязывается к людям, что неизбежно приводит к разочарованиям.

Ее излишняя напористость пугает окружающих, и, со временем, они могут отстраниться от слишком навязчивого друга.

Несмотря на желание контролировать жизнь друзей, девушка Рак-Змея является надежным и верным человеком. Она не способна на подлость и никогда не станет говорить гадости за спиной. Если даму что-то не устраивает, то она всегда выскажет свою точку зрения.

Семья и брак

В семейных отношениях женщина Рак-Змея старается занять лидирующее положение, чтобы иметь возможность контролировать все процессы, происходящие внутри семьи. Если же дома есть человек с более сильным характером, то она легко может уступить главенство. Для таких людей главное, чтобы в семье царил покой и порядок.

Девушка Змея-Рак практически всегда находится в собственном мире и может не реагировать на внешние процессы. Но если кому-то из членов семьи понадобится помощь или поддержка, она приложит все усилия для нормализации ситуации.

Для построения семьи такой человек выбирает надежного и спокойного спутника. В случае необходимости дама может притвориться слабой и мягкой, чтобы избранник почувствовал себя главой семьи.

Для своих детей женщина не жалеет сил и времени. Для нее важно финансово обеспечить семью, чтобы никто из домочадцев ни в чем не нуждался. Такая личность полностью отдается заботе о семейном гнездышке и всегда самостоятельно принимает важные решения.

Совместимость в любви

Девушка Змея-Рак не знает всех романтических тонкостей и не умеет правильно выстраивать любовные отношения. Неудачные попытки понравиться противоположному полу неизбежно приводят к разочарованию. Поэтому серьезные отношения у таких женщин складываются в более зрелом возрасте.

Для отношений такие девушки ищут спокойных, серьезных, амбициозных и финансово обеспеченных мужчин, которые знают, чего хотят от жизни.

Для них важно, чтобы избранник ценил семейные узы и любил детей. На место ее будущего супруга подходит мужчина, полностью соответствующий этим строгим требованиям.

Женщина Змея-Рак всегда остается верна своему избраннику. Она может стать идеальной женой и подругой, если партнер смирится с непростым характером дамы. Такие женщины изменяют только тогда, когда перестают чувствовать любовь супруга. Поэтому мужчина должен всегда проявлять заботу в адрес второй половинки.

Представительнице этого гороскопа нужен мужчина, рожденный в год Дракона или Петуха. Что касается знака Зодиака, то наибольшей совместимостью она обладает с Тельцом, Скорпионом и Рыбами.

Она так же может гармонично сосуществовать с такими знаками, как Бык-Телец, Тигр-Рыбы, Кот-Скорпион и Собака-Рыбы. С другими мужчинами совместимость не такая хорошая, так как требует от обоих партнеров решения множества межличностных проблем.

Отношение к работе

Женщина Рак-Змея обладает напористостью и целеустремленностью, что помогает ей добиваться карьерных высот. Такая дама умеет правильно организовать свои способности, чтобы постепенно добиться желаемой цели.

Ей всегда сопутствует удача, позволяющая достичь финансового благополучия. И хотя деньги для таких людей играют второстепенную роль, вокруг них всегда находятся возможности, которые позволяют получить хорошее финансовое вознаграждение.

Подробнее узнать о данной личности вы сможете в этом видео.

Женщина Змея-Рак: краткая характеристика, совместимость, гороскоп

По восточному гороскопу 1941, 1953, 1965, 1977, 1989, 2001 и 2013 год считаются годами Змеи. Представительницы прекрасного пола, родившиеся в период с 22 июня по 21 июля, относятся к зодиакальному созвездию Рака. Девушка Змея-Рак необычайно прекрасна, загадочна и умна. Это очень сложная натура, одаренная внутренней мудростью и талантом обольщения. Духовный мир женщины закрыт для случайных людей, поэтому открывается исключительно узкому кругу единомышленников.

Общая характеристика

С самого детства девочка ощущает эмоциональную атмосферу в доме. Этот фактор является основополагающим в формировании ее дальнейшей взрослой жизни. Если ребенок чувствует любовь и заботу, из него получится коммуникабельная, самоуверенная и прагматичная личность. Если внимания будет недостаточно, характеристика женщины Змеи-Рака будет отличаться замкнутостью, недоверчивостью и отрешенностью от внешнего мира.

Представительница прекрасного пола данного сочетания обладает прекрасной интуицией и особой осторожностью. Она не переносит трудностей, боится поражений и старается предусмотреть все возможные варианты событий. Иногда девушка позволяет себе быть прямолинейной и вспыльчивой, но в этот момент ей на помощь приходит неимоверное самообладание. Женщина Змея-Рак способна справиться со своими эмоциями, оценить ситуацию и хладнокровно дожидаться благоприятного для себя исхода.

Девушка отличается коммуникабельностью и общительностью, обладает отменным вкусом, природной грацией, великолепным чувством юмора. Это прекрасная актриса, которая умеет демонстрировать невозмутимость в любых ситуациях. При этом ее душа очень чувствительна и ранима. Замечания и обиды со стороны окружающих наносят ей не только моральные, но и физические травмы, которые могут спровоцировать болезни. Именно поэтому обидчик женщины-Рака, рожденной в год Змеи по китайскому гороскопу, никогда не останется безнаказанным. Девушка найдет возможность отомстить и сделает это максимально изысканно.

Положительные качества

Женщина Рак-Змея имеет массу прекрасных черт характера. К ним относятся:

  • мудрость;
  • высокий интеллект;
  • коммуникабельность;
  • прекрасное чувство юмора;
  • сдержанность;
  • прагматичность;
  • целеустремленность;
  • стремление к духовному росту;
  • самодисциплина;
  • сексуальная привлекательность.

Отрицательные качества

В характере представительницы прекрасного пола данного сочетания также присутствуют негативные черты характера, на которые следует обратить внимание. Это:

  • замкнутость;
  • недоверчивость;
  • паникерство;
  • обидчивость;
  • злопамятность;
  • мстительность;
  • чрезмерная ревность;
  • подозрительность;
  • лицемерие;
  • мнительность.

Работа и карьера

Отличительной чертой женщины-Рака, рожденной в год Змеи, является целеустремленность упорство в достижении поставленной цели. Эти качества помогут ей достичь успехов во всех сферах производственной деятельности. Девушкам данного соединения подойдут творческие профессии (актриса, журналист, танцовщица, литератор). Дисциплинированность и разумный прагматизм позволят овладеть ремеслами, связанными с точной информацией (банковский работник, юрист, консультант, научный деятель).

Для прекрасных леди созвездия Змея-Рак финансовая составляющая жизни является второстепенной. Но высшие силы благосклонны к представительницам данного созвездия, поэтому девушки будут всегда хорошо материально обеспечены. Им следует лишь опасаться сомнительных операций при ведении собственного бизнеса и тщательно проверять все сопутствующие документы.


Женщина Рак-Змея отличается верностью и преданностью по отношению к своим друзьям. Ей можно доверять любые секреты, обращаться за помощью, рассчитывать на сочувствие. Она никогда не обманет и не предаст, не станет клеветать и злословить. Девушка предпочтет высказать свое мнение в глаза и решить все вопросы непосредственно со своим другом, а не с посторонними людьми. Она всецело отдается дружбе и требует ответной реакции со стороны партнера. Змея-Рак активно участвует в жизни близкого человека и становится слишком навязчивой. Она контролирует каждый шаг, регламентирует личное время и ревнует ко всем окружающим. Девушкам этого сочетания рекомендуется уважать собственное пространство друзей и появляться в их жизни только тогда, когда ее пригласят.


Гороскоп женщины Змеи-Рака предполагает наличие глубокой чувственности и самоотдачи в вопросах любви. Девушка ищет мужчину, который смог бы ей помочь реализовать мечты о счастливой и обеспеченной жизни. Когда на горизонте появляется вожделенный объект, она делает все возможное и невозможное для того, чтобы его покорить. Иногда это выглядит слишком навязчиво, поскольку женщина старается контролировать каждый шаг своего потенциального избранника. Парень не выдерживает подобного напора и всячески старается освободиться от ненужных оков.

Такое поведение особенно характерно для молодых неопытных девушек, рожденных под соединением данных созвездий. Именно поэтому гармоничные отношения складываются в зрелом возрасте, когда женщина приобретает опыт общения с противоположным полом. Она полностью отдается любви и требует аналогичного поведения со стороны мужчины. Если дама почувствует, что ее разлюбили, без сожаления разорвет отношения или станет изменять.


Семья и брак для женщины Змеи-Рака имеет огромное значение. Она старается держать под контролем все жизненно важные процессы, которые гарантируют счастье всем домочадцам. Сюда входит эмоциональная атмосфера семьи и ее материальное благополучие. Если муж будет настаивать на своем главенстве, представительница созвездия никогда не станет ему препятствовать и предоставит все бразды правления в его руки. Внешне она может показаться беспомощной и слабой, чтобы супруг почувствовал себя настоящим мужчиной. На самом деле, ничего не выйдет из-под ее контроля, поскольку женщине импонирует роль «серого кардинала».

Мужу не удастся ее обмануть или скрыть измену: супруга обязательно все выяснит и отомстит. Она никогда не прощает обид, особенно дорогим для нее людям. Месть будет изощренной и даже жестокой. Змея-Рак очень любит своих детей и делает все для того, чтобы они ни в чем не нуждались. Она постарается обеспечить их материально, окружить своим вниманием и научить всем необходимым жизненным премудростям.

Влияние стихий

Огромное влияние на характер женщины Змеи-Рака имеет влияние стихии, под которой она родилась. В древней восточной традиции существует пять основных элементов:

  • Огонь. Годами Огненной Змеи являются 1857, 1917 и 1977. В этот период на свет появились яркие, энергичные и активные женщины. Основными чертами их характера являются честность, бесстрашие и стремление к лидерству. Женщина-Рак отличается общительностью, красноречием, дружелюбием и прямолинейностью. Она всегда высказывает свое мнение, не боясь ответной реакции со стороны оппонентов. Девушка отдается без остатка только тем, кого она любит и очень строга с недругами. Она способна достичь великолепных перспектив в карьере, поскольку отличается напористостью в достижении своих целей.
  • Вода. Водяная Змея покровительствует 1893, 1953 и 2013 году. Девушки, рожденные в этот период, отличаются интеллигентностью, великодушием и некоторой наивностью. Они стремятся познать истину бытия, с удовольствием увлекаются всевозможными учениями и практиками. Этим увлечениям женщины-Раки года Змеи водяной стихии готовы посвятить всю свою жизнь, что дает им возможность добиться значительных успехов во всех научных сферах деятельности. Представительницы соединения милы и внимательны в общении, готовы совершать множество добрых поступков по отношению к своим близким. Но не стоит расслабляться и забывать о коварстве Змеи. Всех обидчиков и недоброжелателей она сумеет строго наказать в самый неподходящий для них момент.
  • Земля. Годами Земляной Змеи являются 1869, 1929 и 1989. Представительницы этого соединения являются самыми спокойными, уравновешенными и дружелюбными среди всех других стихий. Женщины прекрасно умеют справляться с хозяйством, управлять финансами, строить прочные отношения. Они несколько неторопливы и слишком рассудительно. Но именно эти качества характера дают им возможность достичь высоких показателей в карьере и обрести личное счастье, избегая ошибок. Фортуна всегда благосклонна к женщинам-Ракам, рожденным в год Земляной Змеи, поскольку они настроены оптимистически и всегда видят в людях и событиях все самое лучшее.
  • Дерево. 1905, 1965 и 2025 являются годами Деревянной Змеи. Рожденные в этот период женщины-Раки являются открытыми, прямолинейными и дружелюбными личностями. Они всегда тщательно планируют свою жизнь, устанавливают свои правила и имеют оригинальный взгляд на многие вещи. Представительницы соединения не терпят вмешательства в свое личное пространство и скептически воспринимают замечания в свой адрес. При этом, они с удовольствием делятся полезными советами с окружающими и участвуют в жизни других людей. Женщины-Раки становятся отличными руководителями и администраторами, их дружба и расположение высоко ценится окружающими.
  • Металл. Годами Металлической Змеи являются 1881, 1941 и 2001. Женщины-Раки, которые появились на свет в этот период, отличаются амбициозностью, целеустремленностью и самодостаточностью. Они стараются вести замкнутый образ жизни, никогда не открывают полностью свою душу даже перед самыми близкими людьми. Они привыкли действовать в одиночку, поскольку опасаются предательства со стороны окружающих. Представительницы соединения очень бояться совершить ошибку, поэтому тщательно планируют свою жизнь наперед. Они добиваются больших успехов в профессиональной деятельности и всегда достигают финансового благополучия. Девушек не пугают препятствия и неудачи, у них достаточно выдержки и терпения, чтобы достичь того, чего они хотят от жизни.

Совместимость с другими знаками

Наиболее благоприятная совместимость женщины Рака-Змеи будет с представителями сильного пола, которые родились в год Дракона, Петуха и Быка. Гармоничными будут отношения с Рыбами, Скорпионами и Тельцами по западному гороскопу.

Не рекомендуется вступать в отношения с Тигром и Свиньей. Отсутствием гармоничности характеризуется и общение с партнером, родившимся в год Змеи. Людям данного созвездия сложно найти общий язык.

Мужчина Рак Змея — Совмещенный Гороскоп

Мужчина Рак-Змея сильно выделяется в толпе. Он занимается исключительно своими делами, старается отделиться от мира и ему это часто удается. Такое поведение одиночки не может не вызвать интерес у тех, кто просто хочет понять этого необыкновенного парня. А на самом деле он действует так, чтобы создать для себя отходные пути в любой ситуации, отсюда его стремление действовать не спеша, с оглядкой после тщательных расчетов.

Эти мужчины чрезвычайно талантливы, однако они не могут реализовать все свои таланты. Им стоит выбрать что-то определенное, чтобы их таланты и способности получили полное развитие. Если они примут такое правило к сведению, смогут достичь всего самого лучшего. Они психологи от рождения, поэтому могут помочь многим людям в решении сложных проблем. Они имеют хорошо развитую логику, ум и проницательность.

По характеру эти мужчины являются самыми яркими прагматиками. Они умеют просчитывать все свои шаги. При таких качествах они не всегда могут добиться поставленных целей, так как они увлекающиеся личности и могут отправиться вслед за несбыточной мечтой. Они умеют комично подметить интересные особенности других людей, а это привлекает к ним большую аудиторию, ведь они интересны, веселы и необычны.

Читайте также: Мужчина Рак и Мужчина Змея.

Характеристика мужчины Рака-Змеи в Любви

Он гипнотизирует свою партнершу. Если она стала объектом внимания, то отвертеться у нее не получится, он обязательно привяжет ее к себе. От Змеи он получил способность оценивать женщину без ошибок. Кроме того, он мудр и опытен. А от Рака — ему досталась привязчивость и желание опеки. В результате он создает некоторый шарм, загадки вокруг своей особы и это не может не привлекать все новых поклонниц.

В любви он деспотичен, так как стремится полностью подчинить себе свою возлюбленную. В результате она полностью зависит от него, а он от неё, образуя единое целое. Именно такой странный союз может с ним получиться. Нужно отметить, что женщинам часто нравятся именно такие роковые мужчины, так как они наделены яркой индивидуальностью и готовы на многое ради достижения своих целей.

Читайте также: Мужчина Рак в Любви и Мужчина Змея в Любви.

Мужчина-Рак, рожденный в год Змеи, в Постели

Чтобы его заинтересовать, потребуется много сил и желания. Он будет всегда стараться найти единомышленницу, а не партнершу по интимным играм, поэтому близость рассматривается им, как нечто необходимое. В результате он многим кажется слишком холодным, что соответствует действительности. Следует отметить, что этот мужчина всегда хочет абсолютного лидерства в этих отношениях.

Он относится к интимной стороне любви с прохладцей. Она слишком предсказуем и запрограммирован, чтобы внести в эту сферу необходимый огонь и страсть. Ему нравится повторение одинаковых действий, поз, поэтому он не стремится к экспериментам. Принуждать или предлагать ему воплотить некоторые затеи бесполезно, так как он не интересуется чем-то новым, довольствуется тем, что могут дать стандартные отношения в постели.

Читайте также: Мужчина Рак в Постели и Мужчина Змея в Постели.

Гороскоп мужчины Рака-Змеи в Семье и Браке

Брак с ним может оказаться весьма счастливым, так как он вносит в жизнь размеренность и покой. Он самодостаточен, поэтому ему встречаются женщины слабее него духом. В результате в семье он играет первую скрипку. Следует отметить, что он всегда может оказаться поддержку своей супруге и под его руководством она сможет добиться высоких карьерных позиций и других поставленных целей.

С родственниками отношения не всегда складываются хорошо, так как он любит держать дистанцию и отказывается от участия в некоторых мероприятиях, решении проблем и прочих делах. С детьми отношения строятся по типу – авторитет – подчиненный. То есть дружеских отношений не наблюдается. При этом он очень рад таким отношениям, так как всегда нацелен на послушание и полное подчинение своего окружения.

Читайте также: Мужчина Рак в Браке и Мужчина Змея в Браке.

Мужчина Змея-Рак — Карьера и Финансы

Сделать карьеру для этих мужчин не составляет труда, однако они не всегда стремятся к этому. Они могут увлекаться какими-то идеями, но не получать личной выгоды от этого. При этом у них достаточно качеств для достижения хорошей карьерной позиции – это блистательный ум, логика, проницательность и умение расположить к себе других людей. С финансами они не всегда обращаются правильно, так как часто стремятся к чему-то несбыточному.

Перед тем как выполнять какие-то действия, этим людям рекомендуется тщательно продумать, какие последствия ждут их в будущем. Им стоит больше доверять друзьям и прислушиваться к из советам. Также стоит помнить, что любовные и семейные отношения не смогут быть заменены какими-то идеями, дружбой. Только решительность в романтических отношениях позволит им стать счастливыми, найти свое место в жизни.

Рак Змея — Совмещенный гороскоп

Загадочный, непостижимый Рак-Змея — сложный знак, распознать его истинную сущность очень сложно. Мягкий, уязвимый Рак получает мощную поддержку перед лицом сильной и хладнокровной Змеи. Он перестает нервничать по пустякам, терпеть и метаться в сомнениях, становится мстительным и мстительным. Главная особенность Змеи-Рака — тонкое интуитивное чутье: он не задается вопросами, а просто читает информацию от людей.Поэтому окружающие должны быть предельно осторожны в общении с ним. Не прощайте шуток и нелестных отзывов о себе. Хотя в целом Змея-Рак — обаятельный, жизнерадостный человек, любит людей. Умный, проницательный, образованный, поэтому общение с ним наполнено положительными эмоциями.

Признаки Рака Змеи

Это серьезные, уверенные в себе люди, по крайней мере, такое впечатление производят. Не любят спешки и суеты, очень точны в оценках, редко ошибаются.Они не променяют свою безбедную жизнь на сомнительные приключения. По совмещенному гороскопу Змея-Рак — личность сильная, не нуждается в помощи и советах. Более того, это раздражает навязчивых людей. Этот самодостаточный человек держит с большим достоинством. Не боится одиночества, наоборот, наслаждается тишиной и покоем. Нуждается в личном пространстве, любит размышлять обо всем на свете наедине с собой. При этом умеет развлекаться, любит проводить время в шумных компаниях.Рак-Змея может быть кем угодно: просто идеальным.

Мудрая Змея-Рак знает, как использовать чужие слабости в своих интересах. Обладает сильной интуицией, без лишних слов понимает настроение людей. Его спокойное, загадочное поведение завораживает, он гипнотизирует всех без исключения. Мало кто решается с ним спорить. Змея-Рак всегда знает, как лучше действовать, как будто предвидит грядущие события. Ведет себя настолько уверенно, что люди следуют за ним и слепо доверяют его мнению.Хотя внутри, как и любой Рак, вызывает сомнения, переживает из-за мелочей. Однако хладнокровие Змеи помогает ему в сложных ситуациях, помогает сохранять спокойствие. Этот человек славится выносливостью, умением переносить неприятности.

Змея-Рак — удивительный человек: его нежное, ранимое сердце заключено в стальную оболочку. Очень сложно понять настроение этого человека, потому что все, что находится за пределами невозмутимости, может что-то скрыть. С одной стороны — сострадание и забота о близких людях, а с другой — эгоизм, злость и жестокость.Сильно развитое чувство самосохранения защищает Рака-Змея от рискованных действий, он в первую очередь думает о себе. Поэтому в зависимости от обстоятельств ведет себя по-разному. Но всегда очаровательно, даже гнев на его лице. Со всеми неприятностями справляется самостоятельно, но стоит только попросить о помощи, сразу набегает масса добровольцев. Змея-краб обладает мистической властью над другими.

Раковые змеи — совместимость (Любовь и семья)

Этот человек привлекателен для противоположного пола: отличается привлекательностью и сексуальным магнетизмом.В личных отношениях Рак-Змея не теряет уверенности в себе, именно он является лидером в отношениях. Он ревнив, капризен, у него сильное чувство собственности. По любовному гороскопу Рак-Змея — требовательный партнер: считает, что заслуживает только самого лучшего. А его деспотизм основан на жуткой неуверенности в себе, в любовных отношениях он очень уязвим.

Выйдя замуж, Змея-Рак практически сразу забывает о своей независимости. С добрым сердцем он освобожден от ответственности за благополучие семьи.Скорее, он оставляет себе почетную роль руководителя. С экстазом контролирует жизнь близких людей, причем очень грамотно. Рак-Змея любит свой дом, с удовольствием занимается домашним хозяйством. Ему важно создать комфортные условия для себя и своих близких. Он ревностно оберегает покой своей семьи от постороннего влияния.

Рак змеиный бизнес (карьера и цели)

Осторожный Рак-Змея лишен тщеславия, не стремится к высоким должностям.Действует медленно, тщательно думает о своих перспективах, рассматривает все возможные варианты. Но приняв решение, он упорно добивается задуманного. Ему не нравится риск, он не станет заниматься сомнительным бизнесом, даже если ему обещают огромную прибыль. Рак-Змея человек трудолюбивый, но никогда не работает ради идеи. Неравнодушен к деньгам и не любит их тратить, очень рационально и экономно.

Природное обаяние Рака-Змеи — ключ к сердцам людей.Этому эмоциональному, темпераментному человеку принадлежит дар перевоплощения. Змея-Рак может стать популярным актером, ведь для него любая роль может сыграть талантливую роль — легкая задача и сущий пустяк. Кроме того, его призвание: педагогика. Этот интеллектуально одаренный человек обладает широким кругозором, обладает даром убеждения и развитым красноречием. Умеет правильно подавать информацию, моментально увлекает своими идеями.

Внутри спокойного, хладнокровного мужчины-Рака-Змеи бушуют эмоции, но окружающим не нужно о них знать, по крайней мере, на время.Настолько проницательный и сообразительный, что жизнь его складывается именно так, как он задумал. Если Рак-Змея чем-то недоволен, он может быть жестким и колючим, пока не успокоится. Такое поведение — редкость, обычно умело подстраивает жизнь близких под свои интересы. Действует тонко и расчетливо, окутывает своим внимательным, доброжелательным отношением. Производит впечатление общительного человека, полностью удовлетворенного происходящим вокруг. Однако он ищет уединения, ему нужно укромное место для размышлений.Даже любимая женщина не сможет привлечь его внимание, если он этого не захочет.

Для женщины Рака-Змеи ограничений в общении нет. Действует смело, проявляет себя как активный человек, поэтому неизменно привлекает внимание. Однако тщательно оберегает свой внутренний мир, надежно хранит секреты и секреты. Это скрытный и недоверчивый человек, такой ее знают только действительно близкие люди. Женщина Рак-Змея — человек гордый и эгоистичный, поэтому не терпит непослушания.Достигается его и в решении деловых вопросов, и в личной жизни. Избранный должен признать, что любые возражения бесполезны. Она найдет свое счастье с умным, спокойным и сдержанным мужчиной. К тому же у нее сильная интуиция, всегда поступает правильно. Она очень привязана к своему дому и близким людям.

Рак Змея | Гороскоп Поп

Рак Змеиный характер

Как и Раки, Змеиный вид более независим от тяжелых эмоциональных пут, чем его родственники. Он в семье, чтобы стать уверенным в себе, а также цепляться за него — в конце концов, он одновременно Змея и Рак! Однако Рак, рожденный Змеей, в отличие от других Раков, которых знает и любит большинство из нас, признает свои собственные слабости, понимает свое мрачное настроение и, в результате своей хладнокровной прозорливости, обычно умудряется выскользнуть из сумасшедшего депрессивного состояния. чем Раки могут быть так известны.
Как и Змеи, Раковая Змея будет значительно менее хладнокровной, чем другие змеи. Задумчивая задушевность и глубокая привязанность Рака покрывают Змею одеялом, ласкают его холодную внешность и согревают сердце, превращая его в нечто, близкое к приветливости. Змеи могут быть очень хорошими покупателями. Они извиваются и извиваются, пробираясь и выбывая из любого диапазона сценариев, и умны, как змеи, в обращении большинства условий в свою пользу. В Раке-Змеи эта тенденция хотеть, чтобы главная функция во всех фильмах жизни сдерживалась популярным чувством и чистой сдержанностью.
Все змеи созданы лжецами. Но некоторые лгут намного больше, чем многие другие. Раковые змеи — одно из наименее скользких змей. Они не могли бы обмануть своих бабушек просто для того, чтобы казаться превосходными. Тем не менее, даже разумная Раковая Змея способна скрывать лицемерие и рассказывать гениальные и византийские выдумки. Он не может этого поддержать. Превращение (даже для него самого) — это аспект
в задаче соблазнения и захвата. И все Раки-Змеи хотят, чтобы их считали обаятельными, очаровательными, привлекательными для созерцания, лучше, чем их соседи, и более высокими, красивыми и лучше одетыми, чем кто-либо где-либо еще.
Эти люди не боятся бросать имена и выставлять напоказ ярлыки. Представьте себе великолепного, любящего дом Рака Змея, сидящего на своем дизайнерском диване в дизайнерских джинсах. За его головой — Пикассо. У его ног гигантская пиренейская собака наблюдалась только в самых дальних темных пещерах Андорры. Всем известно, что эти большие звери почти каждый день съедают не меньше одной коровы поменьше, прядут их в стиле а-ля и приносят целое состояние. Почти никогда не думал. Изображение может быть посланием со Змеями-Раками.Независимо от цены или трудностей, вы можете рассчитывать на ваше дружелюбное сообщество Рак Змея для личного, безусловно, самого шикарного и модного из всего.
Между прочим, когда вы не проживаете в сообществе высшего эшелона, вы вряд ли когда-нибудь наверняка встретите одно из этих великолепных существ. Раковые Змеи не тусуются в неряшливых местах. Они могут происходить из бедности, но они созданы, чтобы не оставаться там надолго. Раковые Змеи не только любят комфорт, но и выходят замуж за одного человека из всей банды, который наверняка станет знаменитым и богатым. они верят, что они это изобрели.
Эти люди тоже любят развлекаться. В тот момент, когда они обретут хоть какую-то защиту и узнают несколько «высших» людей, они могут рассчитывать в Раковой Змеи на проведение нескольких из самых щедрых и посещаемых мероприятий в городе. Естественно, Раковые Змеи могут накормить еду вместе с парой барменов, нанять рабочую силу слуг для работы по очищению устриц, а затем они будут циркулировать. По его мнению, Рак-Змея не может эффективно перемещаться среди посетителей, очаровать штаны канцлера Германии, чей пресс-секретарь пообещал, что он бросит взгляд, убедить секретаря художественного музея дать ему персональный показ на грядущем выступлении молодых артистов и одновременная подача напитков — или может? По сути, это не имеет особого значения по той причине, что он не будет.Рак Змеи хотят, чтобы их ждали. И пока они будут позволить себе рабов, они обязательно будут иметь их.
Эти мужчины и женщины очень артистичны. У них есть средства украсить каждую мелочь, которая встречается на их пути. А Раковые Змеи — лучший советчик. Они определенно могут поместить себя в шкуру других людей.
Рак Змеи тоже любят веселье. Они часто там танцуют до рассвета со всей душевной молодежью, наблюдая за чудесными видами и наслаждаясь, оставаясь предметом зависти для всех существующих.И не пренебрегайте Раковой Змеей, чтобы быть «той женщиной, которая на прошлой неделе разделась до нижнего белья в шикарном клубе наверху в Сохо». Раковые Змеи обладают капризной жилкой. Они хотят, чтобы их считали немного возмутительными или экзотическими.

Рак Змея Совместимость

Телец-Бык, Дева-Бык, Скорпион-Бык, Рыбы-Бык.


Год Змеи

Что ж, мы пережили конец света. Однако, поскольку мы начинаем новый год, мы можем ожидать обычного потока прогнозов относительно того, что нас ждет в ближайшие 12 месяцев.

Это год змеи по китайскому зодиаку, но, может быть, любой год с цифрой «13» на конце следует рассматривать с трепетом? У нас есть НАСА, предсказывающее потенциальные солнечные вспышки, которые могут вывести из строя связь с Землей, у нас есть мировые экономисты, неуверенные и обеспокоенные мировой экономикой, Нострадамус, несомненно, вмешается в разговоры о Третьей мировой войне, и полярный лед будет самым тонким из них. когда-либо было (как и волосы на голове Малькольма).

А что насчет предстоящего года, прогнозируем ли мы тревожные времена для медицинских коммуникаций в 2013 году? Есть ли в этом меняющемся мире, где технологии ускоряют движение к будущему, остается ли место для нас и творческих идей, которыми мы все дорожим? Будут ли по-прежнему оценены коммуникации будущего за качество концепции, которая ими движет? В 2013 году креативная идея по-прежнему будет править своей многоканальной империей или все будет связано с экономикой реализации, а не идеей? Прогнозируем ли мы конец творчества в том виде, в каком мы его знаем?

Итак, что общего между хорошими коммуникациями? Как и лучшие работы, которые мы рассмотрели здесь, и как и все, кто родился в год Змеи, они проницательны, хитры, умны и мудры.И чем бы мы ни занимались в будущем, мы знаем, что идея все равно будет главной. Конечно, мы всегда смотрим на новые технологии и ориентируемся на новейшие каналы связи, но мы знаем, что без хорошей идеи, поддерживающей какой-либо результат, это не стоит ни одного многоканального цента. Эффективное общение всегда будет зависеть от сильного творческого мышления и отличной реализации, независимо от того, говорим ли мы о цифровых, видео или традиционных СМИ. Мы прогнозируем, что 2013 год не станет исключением.

Давайте оглянемся на некоторые «большие идеи» 2012 года и посмотрим, дают ли они какие-нибудь подсказки на год вперед.

Оцените змею…

Sativex — MS спастичность


Агентство: Langland

Давайте начнем с обычного объявления рекламного агентства.

Утрата независимости, неспособность выполнять даже самые простые задачи — это трудные и ужасающие концепции. Чтение о последствиях спастичности рассеянного склероза отрезвляет, но, возможно, мы сможем легче поддерживать нашу эмоциональную бдительность, когда сталкиваемся с письменным словом.Но здесь последствия этой коварной болезни отражены таким образом, что поражает зрительные органы чувств с, возможно, изначально заниженной, но затем острой как бритва и пугающей кишкой ясностью. Копия должна быть дополнена; он не борется за то, чтобы произвести свое собственное воздействие, и поэтому действует как подходящая фольга для силы визуального восприятия. Планировка сбалансирована, контролируется и продумана. В целом, это концепция, которой любое агентство может гордиться и напоминать клиентам, для чего агентство нанимается.

Отличная идея работает на любых носителях, и это отличная идея.Тот факт, что мы рассматриваем двумерный, нецифровой пример кампании, не умаляет силы ключевой концепции или ее потенциала, в какой бы форме она ни появлялась. Когда мы часто говорим о необходимости интерактивного общения, я бросаю вызов любому, кто отрицает, что это связано на всех уровнях. Это идея, которая останавливает вас на пути, а затем глубоко трогает.

Сайт Publicis


Агентство: Publicis Life Brands Resolute

Это цифровой продукт! В нем есть слово «веб-сайт», и для наиболее технически подкованных гиков среди нас (фактически, среди вас) они также показывают нам двоичный код и алгоритм карты сайта в различных исполнениях.Однако, прежде всего, это отличная идея — очень простая, неожиданная, уникальная и запоминающаяся идея. И независимо от того, куда технологии скользят и скользят в будущем, идея все равно будет удерживать весь байт!

Осведомленность NHS о раке груди


Агентство: McCann Health

Идеи груди просты.

Этот пример обеспечивает серьезное и смертельно важное сообщение. Как цитирует Cancer Research UK: «Рак груди — третья по частоте причина смерти от рака в Великобритании, на которую приходится 7 процентов всех случаев смерти от рака.Это вторая по распространенности причина смерти от рака среди женщин (2010 г.) в Великобритании после рака легких, на которую приходится около 15 процентов случаев смерти женщин от рака ».

Факты неопровержимы, статистика пугает, а слово «C» — это то, с чем действительно никто не хочет возражать. Мы все потеряли кого-то из-за рака. Это тема, пронизанная обидой, и, возможно, из-за этого мы до сих пор не принимаем мер предосторожности, которые, как мы действительно знаем, следует принимать.

Этот фрагмент представляет собой очень короткое видео, а идея очень проста; вот что делает его таким эффективным.Два тревожных звонка, которые выглядят как аналогия двух грудей, с лаконичным и понятным сообщением, которое доставляется правильным тоном (игра слов). Это увлекательно, но не выглядит банальным, пугающим или снисходительным. Сложный предмет, с чутким обращением, который должен подать сигнал тревоги для любого человека.

Центральная основная идея с ее прямой визуальной аналогией достаточно сильна, чтобы требовать внимания от начала до конца. Это не только отличная креативная идея, но и очень интересный ролик.

Пожалуйста, включите JavaScript для просмотра комментариев.

Пептидов змеиного яда для борьбы с раком и супербактериями

Катионные пептиды, включая AMP и ACP, охватывают семейство пептидов с разнородной последовательностью, характеризующихся чистым положительным зарядом и высоким содержанием гидрофобных остатков [46]. Первоначальная функция, предложенная для катионных пептидов, заключалась в том, чтобы действовать как AMP против широкого спектра грамположительных и грамотрицательных бактерий, грибов и паразитов [47, 48]. Последующие исследования продемонстрировали противовирусные и антибиотикопленочные свойства, а также противораковую и иммуномодулирующую активность [49,50].Из-за их способности перемещаться через липидные мембраны катионные пептиды также используются в качестве векторов доставки ().

В частности, AMP и ACP вносят вклад в клиренс микробов / опухолевых клеток тремя дополнительными способами: (i) прямое разрушение мембран; (ii) вмешательство в ключевые внутриклеточные процессы, такие как синтез нуклеиновой кислоты и белка; (iii) рекрутирование или активация функции иммунных клеток посредством широкого набора функций с конечной целью очистки от патогенов или опухолевых клеток [51,52,53,54,55,56].Кроме того, антиангиогенез [57,58] и подавление метастазов [59] также способствуют контролю опухоли с помощью ACP. Встречающиеся в природе катионные пептиды присутствуют во всех царствах и типах, включая растения [60], животных [61], грибы [62] и бактерии [63], и они также были идентифицированы в SV.

2.1.1. SV-кателицидины (SV-CATH)

Возможно, самым большим семейством SV-AMP и -ACP, описанных на сегодняшний день, являются кателицидины (CATH), группа структурно разнообразных биоактивных пептидов с антимикробными, противораковыми и иммуномодулирующими функциями, действующих как эффектор. молекулы врожденной иммунной системы [64,65].Члены семейства CATH обладают высокогомологичными пре- и про-регионами, включающими N-концевой сигнальный пептид и кателин (ингибитор L катепсина) -подобный домен [66,67] (a). Напротив, С-концевой домен, который кодирует зрелый биоактивный пептид, разнообразен по аминокислотной (аа) последовательности и более высокой структуре [66,67].

Змеиные CATH. ( a ) Схематическое изображение структуры предшественника CATH. Домены обозначены разными цветами, а сайты расщепления выделены.Также аннотируется паттерн Cys-спаривания. ( b ). Выравнивание последовательностей предшественников CATH. Расширенная информация о последовательности доступна в Таблице S1. Это множественное выравнивание последовательностей было выполнено с использованием Clustal Omega [115] и представлено с помощью программного обеспечения Jalview v2.11.0 [116]. Остатки были окрашены в соответствии с отображаемыми доменами ( и ). Аннотации домена выполнялись с использованием UniProt [117], Национального центра биотехнологической информации (NCBI, https://www.ncbi.nlm.nih.gov/protein) или по гомологии (таблица S1).Фон окрашен в соответствии с процентом остатков в соответствии с согласованной последовательностью, отображаемой внизу.

В то время как большинство зрелых CATH представляют собой линейные амфипатические α-спиральные пептиды с 25–35 остатками, некоторые члены семейства (протегрины) имеют меньшие по размеру пептиды с 12–18 остатками, демонстрирующие β-шпильочные структуры, стабилизированные дисульфидными связями. Другие состоят из последовательностей, обогащенных специфическими аминокислотными остатками, такими как индолицидин с высоким содержанием Trp [68]. Несмотря на эту конформационную и композиционную изменчивость, большинство CATH обладают определенными физико-химическими свойствами, включая в целом положительный заряд и амфипатичность.

CATH были обнаружены у людей (LL-37) и других млекопитающих [69,70,71,72,73,74], а также у рыб, птиц или рептилий [75,76,77]. CATH, происходящие из SV (SV-CATH), были впервые идентифицированы Zhao et al. в 2008 г. из библиотек кДНК ядовитых желез эластичных [76]. На сегодняшний день идентифицировано 25 SV-CATH, а также фрагменты, полученные из родительских SV-CATH (см. Сводку зрелых SV-CATH и их основных активностей, а также Таблицу S1 для предшественников SV-CATH).

Таблица 2

Зрелые кателицидины змеи (CATH), идентифицированные на сегодняшний день, и их свойства.Информация была взята из литературы или Национального центра биотехнологической информации (NCBI). Каждому CATH было дано единое название в соответствии с биномиальными инициалами змеи. Биологическая и гемолитическая активность экспериментально подтвержденных CATH. Гемолитическая активность означает, что вызывает 10% гемолиз (низкий: HC 10 > 50 мкг / мл; средний, 50> HC 10 > 10 мкг / мл; высокий, HC 10 <10 мкг / мл) nd: не обнаруживается деятельность.

Активность Офиофаг Ханна
Исходный организм Унифицированное название Общее название Зрелая пептидная последовательность Длина Гемолиз Ссылка
Oh-CATH KF-34 KRFKKFFKKLKNSVKKRAKKFFKKPRVIGVSIPF 34 Среда G + и G- бактерии. [76,82,83,84]
Bungarus fasciatus, , шт. Bf-CATH Cath-BF KRFKKFFRKLKKSVKKRAKEFFKKPRVIGVSIPF 34 High G + и G- бактерии. [85,86]
Bf-CATh40 BF-30, кателицидин-BF, C-BF, кателицидин-WA, CWA KFFRKLKKSVKKRAKEFFKKPRVIGV6 9018 9018 G183 9018 G183 9018 G186 9018 G183 9018 G183 9018 G183 9018 G183 грибы и опухолевые клетки.Противовоспалительное. Активация врожденного иммунитета. [87,88,89,90,91,92,93,94,95,96,97]
Наджа атра Na-CATH KRFKKFFKKLKNSVKKRAKKFFKKPKVIGVTFPF 34 Низкий G + и G- бактерии. [98,99,100,101,102,103,104]
Hydrophis cyanocinctus Водоросль обыкновенная Hc-CATH KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL 30 Низкий G + и G- бактерии и грибы.Противовоспалительное. Неактивен в отношении опухолевых клеток. [105,106]
Crotalus durissus terrificus Cdt-CATH кроталицидин, Ctn KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF 34 High G + и G- бактерии, грибы, паразиты и опухолевые клетки. В целом провоспалительный. [84,107,108,109,110]
Ботропс атрокс Ba-CATH батроксицидин, BatxC KRFKKFFKKLKNSVKKRVKKFFRKPRVIGVTFPF 34 High G + и G- бактерии и паразиты.В целом провоспалительный. [84,110,111]
Псевдоная ткань Pt-CATh2 Pt-CRAMP1 KRFKKFFMKLKKSVKKRVMKFFKKPMVIGVTFPF 34 High G + и G- бактерии. [84]
Lachesis muta rhombeata Lmr-CATH лачесицидин KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTFPF 34 n.d. н.о. [84]
Ботропс Лутци Bl-CATH луцицидин KRFKKFFKKLKNNVKKRVKKFFRKPRVIGVTIPF 34 н.о. н.о. [84]
Питон bivittatus Pb-CATh2 CATHPb1 KRFKKFFRKIKKGFRKIFKKTKIFIGGTIPI 31 Low G + и G- бактерии и грибы. Хемотактический. Противовоспалительное средство. [112]
∆Pb-CATh2 ∆Pb-CATh2 RVKRFKKFFRKIKKGFRKIFKKTKIFIG 28 Среда бактерий G + и G +. [113]
Pb-CATh3 CATHPb2 KRNGFRKFMRRLKKFFAGGGSSIAHIKLH 29 Низкий G + и G- бактерии и грибы. Хемотактический. Слабое противовоспалительное действие. [112]
∆Pb-CATh3 Pb-CATh4 HRVKRNGFRKFMRRLKKFFAGG 22 Средний или низкий G + и G- бактерии. [113]
Pb-CATh4 CATHPb3 KRFQNFFRELEKKFREFFRVYRITIGATIRF 31 Низкий Неактивен против G + и G- бактерий. Иммуномодулирующие средства неактивны. [112]
Pb-CATh5 CATHPb4 TRSRWRRFIRGAGRFARRYGWRIALGLVG 29 Средний или высокий G + и G- бактерии и грибы. Слабое противовоспалительное действие. [112]
∆Pb-CATh5 ∆Pb-CATh5 TRSRWRRFIRGAGRFARRYGWRIA 24 Среда G + и G- бактерии и опухолевые клетки. [113]
Pb-CATH5 CATHPb5 SPPQAMGFPPQVNVEHYIPASYSVAALTVTEEE 33 Низкий Неактивные бактерии и грибы. Иммуномодулирующие средства неактивны. [112]
Pb-CATH6 CATHPb6 RAAPQRRLRAMARLKKFAEAGGADPDSGGLRARFPER 37 Низкий Неактивные бактерии и грибы. Слабое противовоспалительное действие. [112]
Sinonatrix кольцевидный Sa-CATH KFFKKLKKSVKKHVKKFFKKPKVIGVSIPF 30 Низкий G + и G- бактерии и грибы.Противовоспалительное. [114]
Protobothrops mucrosquamatus Pm-CATH KRFAGFFQFVVGVSFRF 17 н.о. н.о. NCBI

В целом, предшественники SV-CATH варьируются от 184 до 194 а.о., за некоторыми исключениями (Таблица S1). Домен сигнального пептида включает ~ 22 N-концевых аминокислотных остатка, за которыми следуют 65-66 аминокислотных остатков, образующих кателиновый домен. 30–34 С-концевых аминокислотных остатка кодируют зрелый пептид, которому иногда предшествует Glu-богатый домен из 9–29 аминокислот, ответственный за инактивацию зрелого пептида, вызывая конформационные изменения [78].CATH из Python bivittatus , Thamnophis sirtalis и Protobothrops mucrosquamatus демонстрируют исключения из вышеупомянутых доменных характеристик, представляя разную длину или даже отсутствуя в некоторых случаях (Таблица S1).

Змеиные предшественники CATH обычно демонстрируют> 50% идентичности последовательностей, за исключением четырех из шести CATH, предсказанных на основе boid, P. bivittatus (Pb-CATH 2, Pb-CATH 4, Pb-CATH 5 и Pb-CATH 6) и один предсказанный по колубриду, T.sirtalis (Ts-CATH 4) (Рисунок S1). Анализ последовательности (b) выявляет консервативные остатки в N-концевой части сигнального домена, а также в большей части кателинового домена и на C-концевом конце, кодирующем зрелый активный пептид. суммирует основные биологические активности зрелых SV-CATH и сравнивает экспериментально подтвержденные SV-CATH с точки зрения биологической активности, гемолиза и селективности в отношении микробных / опухолевых клеток, а не здоровых эукариотических клеток.

Таблица 3

Свойства зрелых CATH, полученных из змей.Гемолитическая активность (HC 10 , мкг / мл) и биологическая активность (минимальная ингибирующая концентрация (MIC) или IC 50 , мкг / мл) в отношении репрезентативных или клинически изолированных (CI) микроорганизмов и опухолевых клеток были получены из опубликованных источников. Если в литературе доступно более одного значения, приводится диапазон. Коэффициент селективности рассчитывали как HC 10 / MIC или HC 10 / IC 50 . Для расчета коэффициента селективности использовали значения MIC по сравнению с эталонными штаммами, если не обозначено (*).Для расчета коэффициента селективности было выбрано наиболее ограничивающее значение интервала (максимальное значение MIC или IC 50 и минимальное значение HC 10 ). н.о .: активность не обнаруживается.

Микроорганизм: Пептид: Oh-CATH Bf-CATH Bf-CATh40 Hc-CATH Cdt-CATH Ba-CAT2 -CATh2 ∆Pb-CATh3 ∆Pb-CATh5 Pb-CATh2 Pb-CATh3 Pb-CATh4 Pb-CATh5 Pb-CAT163
Гемолиз (HC 10 )
~ 200 ~ 31 50 -> 400 > 200 ~ 104 ~ 53 ~ 13 ~ 64 > 64 ~ 64 > 100 100186 > 100 <100 > 100 > 100 > 200
Грамотрицательные бактерии (МИК)
E.coli ATCC 25922 0,25–8 8 2,3–8 2,3 0,25–0,78 0,25–0,78 2 2 3 1 3 1 1 nd 18,8 н.о. н.о. 18,8
E. coli (CI) 2–20 0,6–16 2,3–9,4 16 16 16 4.7 9,4 75 н.о. 18,8 н.о. н.о. 75
Коэффициент селективности 25 4 6 > 87 133 68 7 32 > 21 64 > 11 > 3 > 11
Грамположительные бактерии (МИК)
С.aureus ATCC 25923 4–64 16 16> 400 4,7–25,8 32 32 32 > 128 > 128 > 128 н.о. 18,8 н.о. н.о. 75
S. aureus (CI) 8–64 32–64 16> 400 4,7> 200 32 32 32 4.7–37,5 75 н.о. 18,8 н.о. н.о.
Коэффициент селективности 3 2 <0,1 > 8 3 2 0,4 <0,5 0,5 <0,5 > 3 <5 > 3
Грибки (MIC)
С.albicans ATCC 2002 4,7
C. albicans (CI) 2,3–4,7 10–40 9.4–18,8 18,8–37,5 н.о. 9,4–18,8 н.о. н.о. 18,8–37,5
Коэффициент селективности 11 43 * 3 * > 5 * > 3 * <5 * > 5 *
Опухолевые клетки (IC 50 )
ПК-3 (рак простаты) 70.2 н.о.
U937 (лейкемия) <4
MCF-7 (рак груди) n.d. 353 ~ 64
HepG2 (рак печени) н.о.
Коэффициент селективности 0.7 > 26 1
Арт. [76,84] [85] [93,94,96,97] [105,106] [84,107,108,122,123] [84] [84] [113] [113] [113] [112] [112] [112] [112] [112] [112] [114]
Цветовой код: Гемолиз: Низкий (> 50) Средний (50–10) высокий (> 10)
Биологическая активность (MIC / IC 50 ): Низкий (> 50) Средний (50–10) Высокая (<10)
Неселективный (коэффициент <1) Селективный (коэффициент> 1)
  • Oh-CATH: обнаружен в ядовитой железе королевской кобры ( O.hannah ), это был первый предсказанный SV-CATH, который был синтезирован и экспериментально подтвержден как AMP [76] (). Oh-CATH проявляет сильную солеустойчивую, антибактериальную активность против грамположительных и грамотрицательных бактерий (MIC в диапазоне 1–20 мкг / мл) со слабым гемолизом (гемолиз ~ 10% наблюдается при 200 мкг / мл) [76, 79]. Он, по-видимому, мембрано-активен и является ингибитором АТФ-синтазы [80,81]. Коллекция аналогов, разработанная Zhang et al. Для изучения взаимосвязей между структурой и функцией Oh-CATH, предполагает, что четыре N-концевых аминокислотных остатка ответственны за цитотоксичность по отношению к эукариотическим клеткам, в то время как C-концевые 10 сильно влияют на антимикробную активность. [79].Соответственно, OH-CATh40, наиболее многообещающий аналог, лишенный четырех N-концевых аминокислот, также названный OH-CATH (5-34), был дополнительно охарактеризован и оптимизирован. Затем OH-CATh40 был протестирован на панели из 584 клинических изолятов 14 различных видов, продемонстрировав антибактериальную активность против 85% из них и в целом более высокую эффективность против грамположительных штаммов [82].

Li et al. успешно уменьшил размер OH-CATh40, удалив 10 C-концевых аминокислотных остатков и включив одиночные мутации, приводящие к возникновению OH-CM6, который проявляет почти идентичную активность против группы грамположительных и грамотрицательных бактерий [81].Хотя OH-CATh40 и OH-CM6 проявляли сильную антибактериальную активность (МПК от 1,56 до 12,5 мкг / мл против клинических изолятов из E. coli , P. aeruginosa и метициллин-резистентного S. aureus (MRSA)), оба оказались неактивными в отношении штаммов Candida albicans (МПК> 200 мкг / мл) [81]. L-формы обоих пептидов сохраняют некоторую антимикробную активность в присутствии 25% сыворотки, вероятно, из-за механизма нацеливания на мембрану до того, как произойдет ферментативная деградация, но предварительная инкубация в 100% сыворотке приводит к полной потере активности через 4 часа.Напротив, активность их D-аминокислотных форм оставалась неизменной даже после 12 ч предварительной инкубации в 100% сыворотке [81]. Исследования in vivo, проведенные той же группой, показали, что внутрибрюшинная ( i.p. ) LD 50 с OH-CATh40 и OH-CM6 у мышей составляла 120 и 100 мкг / г, соответственно. Оба пептида были способны спасти инфицированных мышей в модели бактериемии, индуцированной лекарственно-устойчивой штаммом E. coli в дозе 10 мкг / г, а также снижали выработку TNF-α на мышиной модели нейтропенической инфекции бедра [81].

  • Na-CATH: этот CATH из ядовитой железы китайской кобры N. atra [76] также продемонстрировал мощную, солеустойчивую антимикробную активность против грамположительных и грамотрицательных бактерий, в том числе Francisella novicida (невирулентный штамм человека, родственный Francisella tularensis , возбудителю туляремии) [98], E.coli, Aggregatibacter actinomycetemcomitans , Bacillus cereus [99], P.aeruginosa [100] и S. aureus [101] в низких концентрациях (ЕС 50 <3 мкг / мл). Na-CATH также активен против Mycobacterium smegmatis [102], Burkholderia thailandensis (близкородственного к B. pseudomallei , возбудителю мелиоидоза) [103] и Bacillus anthracis [104] (сибирская язва). Последние два штамма имеют особое значение из-за их потенциального использования в качестве биологического оружия. Действительно, исследования in vivo с использованием личинок восковой моли показали, что Na-CATH способен спасти 100% восковых червей после B.anthracis Sterne инфекция при низких концентрациях пептида [104]. Кроме того, Na-CATH не только активен против планктонных бактерий, но также ингибирует образование биопленок S. aureus и B. thailandensis [101,102], вызывая минимальный гемолиз (<2% при 100 мкг / мл) [99 ]. Однако Na-CATH не ингибировал образование биопленок Pseudomonas [100].

Структурно Na-CATH сворачивается в четко выраженную амфипатическую α-спираль между остатками Phe3 и Lys23 в присутствии трифторэтанола.Оставшийся хвост из 11 остатков, состоящий в основном из ароматических и гидрофобных остатков, не имеет определенной структуры, но, по-видимому, взаимодействует с липидными мембранами [118]. Na-CATH содержит последовательность из 11 остатков [KR (F / A) KKFFKK (L / P) K], известную как мотив ATRA, повторяющуюся дважды и почти полностью разделяемую другими SV-CATH (). Мотив ATRA при тестировании сам по себе также активен, но Pro в положении 10 резко снижает его антибактериальную активность, вероятно, за счет дестабилизации его спиральной структуры, в то время как изменение Phe на Ala в положении 3 не снижает активности [98,99] .

Du et al. постулировали, что Na-CATH способен разрушать бактериальные мембраноподобные липосомы за счет истончения мембран или образования временных пор [118]. Эта гипотеза была дополнительно подтверждена in vitro Gupta el al. и Juba et al., которые описали деполяризацию мембраны и формирование временных пор у Mycobacterium smegmatis [103], а также у E.coli и B. cereus [119] после обработки Na-CATH. Однако Samuel et al. предложили более подробный механизм перехода от разрушения мембраны к лизису на основе пор, в зависимости от липидного состава и фазы липосом [120].

  • Bf-CATH: в отличие от других 34-аминокислотных AMP, предсказанных как SV-CATH, очищенный пептид из ядовитой железы Bungarus fasciatus представляет собой 30-аминокислотный пептид, лишенный четырех N-концевых остатков (). Это различие в длине предполагает различный ферментативный процессинг, а не предполагаемое расщепление эластазоподобной протеазой в консервативном сайте (Val) или пост-процессинг предшественника из 34 остатков [97]. Экспрессия Bf-CATH широко распространена, включая желудок, трахею, кожу, мышцы, сердце, почки, легкие, мозг, кишечник, селезенку, печень, яичники и ядовитые железы [97].

Как и другие SV-CATH, Bf-CATH имеет конформацию случайных клубков в водном растворе, но принимает α-спиральную структуру в гидрофобных или мембраноподобных средах, в частности, от остатков Phe2 до Phe18 [97]. Bf-CATH обладает мощным антимикробным действием против широкого спектра клинически изолированных, устойчивых к лекарствам грамотрицательных и грамположительных бактерий, а также сапрофитных грибов [97]. Анализы in vitro и in vivo демонстрируют, что Bf-CATH частично сохраняет антибактериальную активность в присутствии сыворотки крови человека, но не в желудочно-кишечных жидкостях.Его меченный флуоресцеином аналог может абсорбироваться в кровеносную систему мыши в течение 30 минут после внутрибрюшинной инъекции без накопления в тканях (полностью выводится через 24 часа) [121]. Интересно, что Bf-CATH был менее склонен к индукции устойчивости бактерий, чем классические антибиотики, такие как ципрофлоксацин или гентамицин, при введении в сублетальных концентрациях [94]. Bf-CATH продемонстрировал разрушающую мембрану антибактериальную активность [94], а также способность ингибировать секрецию провоспалительных молекул, таких как TNF-α, IL-8, IL-1 или MCP-1 (хемоаттрактантный белок моноцитов-1 ) и ингибировать продукцию O 2 · , индуцированную Propionibacterium acnes (обыкновенные угри) [95].

Исследования in vivo, проведенные Wang et al. продемонстрировал общий противовоспалительный эффект Bf-CATH и уменьшил гранулематозное воспаление, вызванное P. acnes, , выявив его терапевтический потенциал для лечения акне [95]. In vivo , Bf-CATH снижал бактериальную нагрузку и колонизацию в мышиных моделях инфекций, вызванных P. aeruginosa и Salmonella typhimurium , ослабляя симптомы и кишечные изменения [94,121]. Bf-CATH также продемонстрировал in vivo предотвращение дисфункции кишечного барьера на моделях липополисахарид-индуцированной эндотоксемии / воспаления у мышей и поросят, предположительно путем подавления экспрессии TNF-α через сигнальный путь NF-κB [89,92].Параллельное подавление передачи сигналов NF-κB и активация сигнального преобразователя и активатора транскрипции 1 (STAT-1) у поросят-отъемышей, по-видимому, помогает подавлять воспаление кишечника и усиливать фагоцитоз иммунных клеток, а также модулировать иммунные ответы кишечника во время стресса. воспалительные процессы, например отлучение от груди [91]. Недавнее исследование Liu et al. предположили, что предварительная обработка Bf-CATH ослабляет -индуцированную P. aeruginosa пневмонию за счет усиления NETosis (активации и высвобождения внеклеточных ловушек нейтрофилов), подтверждая иммуномодулирующую активность Bf-CATH [88].

Была также исследована противоопухолевая активность Bf-CATH, которая показала сильную активность in vitro против клеток меланомы мыши (IC 50 ~ 7 мкМ) и ингибирование in vivo пролиферации, миграции и ангиогенеза клеток меланомы мыши, но с незначительный эффект против линий опухолевых клеток человека (IC 50 s от ~ 20–100 мкМ). Его противоопухолевый механизм связан с проницаемостью мембраны, связыванием ДНК и предотвращением экспрессии гена фактора роста эндотелия сосудов (VEGF) [93].

Различные стратегии обращались к взаимоотношениям структура-активность Bf-CATH для оптимизации его активности [86,87,96,97,124,125,126,127]. Например, 15-аминокислотный BF-15 в основном сохраняет антимикробную активность Bf-CATH, проницаемость мембран и более стабилен в сыворотке, чем нативный пептид [96,97]. Cbf-K16, аналог Bf-CATH, полученный путем замены Glu16 ➝ Lys, также показал антибактериальную активность против рекомбинантной металло-бета-лактамазы-1 (NMD-1) из Нью-Дели, несущей E.coli , а также улучшенная противоопухолевая активность против клеток карциномы легких человека и мыши по сравнению с Bf-CATH, оба эффекта предположительно достигаются за счет разрушения мембраны и связывания ДНК [125,126]. Также были разработаны Trp / Arg-богатые аналоги Bf-CATH, из которых ZY13, наиболее мощный и наименее гемолитический аналог, проявлял in vitro антибактериальные и многообещающие противогрибковые и противовоспалительные свойства как in vitro, так и у мышей C. albicans -индуцированная модель вагинита [87].

Наконец, были исследованы системы производства и доставки Bf-CATH.Инкапсуляция Bf-CATH была испытана в микросферах поли (D, L-лактид-гликолид) (PLGA) и блок-сополимерах поли (этиленгликоль) -поли (молочная кислота-гликолевая кислота) (4-рукава-PEG- PLGA). Обе системы сохранили антибактериальную активность свободного антимикробного пептида и высвобождали Bf-CATH в течение> 15 дней [128,129]. Также сообщалось, что различные стратегии рекомбинантной ДНК эффективно продуцируют Bf-CATH, такие как технология малых убиквитин-родственных модификаторов (SUMO) или технология на основе интеина, обе экспрессируются в Bacillus subtilis (достигнуты выходы пептидов ~ 3 мг / л и 0%). .5 мг / л соответственно) [130, 131].

  • Cdt-CATH: , также называемый кроталицидином (Ctn), представляет собой 34-аминокислотный пептид из яда южноамериканской гремучей змеи ( Crotalus durissus terrificus ). Среди SV-CATH, идентифицированных у ямочных гадюк Falcão et al. [84] (луцицидин, лачесицидин, батроксицидин, вместе называемые виперицидины), Ctn был наиболее изучен, демонстрируя сильные бактерицидные эффекты против грамотрицательных и грамположительных бактерий (МПК <10 мкМ) [84], противопаразитарные (антипаразитарные) -trypanosomatid) активность [109] и активность против условно-патогенных дрожжей и дерматофитов, отдельно или в комбинации с обычными противогрибковыми средствами [108].Кроме того, Ctn показал сильную противоопухолевую активность против различных линий лейкозных клеток (IC 50 s <5 мкМ) [107].

Общий механизм Ctn против бактерий или паразитов связан с мембранами, и его способность вмешиваться и разрушать биологические мембраны подробно описана [109,122]. Токсичность Ctn по отношению к лейкозным клеткам также связана с его мембранолитическим эффектом, хотя, по-видимому, он также может влиять на ключевые внутриклеточные пути, что в конечном итоге способствует гибели опухолевых клеток (Pérez-Peinado et al., Отправлено). В дополнение к прямому цитотоксическому эффекту были исследованы иммуномодулирующие свойства Ctn, показывающие общий провоспалительный профиль в присутствии инактивированных нагреванием бактериальных антигенов и IFN-γ [110], в отличие от общего противовоспалительного действия других SV-CATH.

Со структурной точки зрения исследования кругового дихроизма и ядерного магнитного резонанса (ЯМР) показывают, что Ctn полностью находится в конформации случайной спирали в водном растворе, но может изменять свою структуру в мембраноподобных средах (т.е.е., мицеллы додецилфосфохолина), демонстрируя конформацию α-спирали на N-конце (остатки 3–21) плюс С-концевой случайный хвост спирали (a) [107]. Структура Ctn очень похожа на те, что предложены для Na-CATH и Bf-CATH (N-терминальная α-спираль плюс случайный C-членный конец спирали), предполагая общий шаблон, общий для SV-CATH.

Трехмерные структуры, принятые в SV-AMP и -ACP. ( a ) кроталицидин (Ctn), PDB 2MWT. ( b ) Cdt-defensin, предсказание трехмерной структуры, полученное с использованием веб-сервера Iterative Threading ASSEmbly Refinement (I-TASSER) [136] (доступно по адресу: https: // zhanglab.ccmb.med.umich.edu/I-TASSER/). ( c ) Кротамин, PDB 4GV5. ( d ) Омваприн, PDB 3NGG. Представление было выполнено с использованием молекулярной графической системы PyMOL, версия 2.0. Schrödinger, LLC [137]. Цветовой код: синий для α-спирали, пурпурный для β-листа и розовый для петель. Дисульфидные пары также обозначены желтым цветом.

Рациональное рассечение Ctn с участием ферментативного расщепления in silico было выполнено Falcao et al. чтобы определить более короткий активный мотив [107]. Два фрагмента образовались в результате расщепления по Val14: Ctn [1–14] и Ctn [15–34].Удивительно, но первый оказался неактивным, независимо от его амфипатической α-спиральной конформации. Напротив, последний сохранил часть активности Ctn, несмотря на его общую неупорядоченную структуру. Фактически, Ctn [15–34] проявляет более низкие гемолитические и цитотоксические эффекты, чем его предшественник Ctn, несмотря на улучшенную селективность в отношении грамотрицательных бактерий и повышенную стабильность в сыворотке человека, предположительно из-за связывания с белками сыворотки и его предпочтительного каркаса [107,132,133]. Ctn [15–34] утратил активность против дерматофитов, но имел повышенную активность против патогенных дрожжей, таких как несколько (мультирезистентных) видов Candida (с множественной устойчивостью), и действовал синергетически с амфотерицином B [108, 134].Хотя Ctn также был способен вызывать некроз всех форм развития T. cruzi (возбудителя болезни Шагаса), Ctn [15–34] сохранил активность только против трипомастиготной формы [109]. Фрагмент также показал противовирусную активность против вируса инфекционного мионекроза, эпизоотического агента, который угрожает выращиванию креветок в Бразилии и для которого в настоящее время не существует лечения [135]. Подобно Ctn, Ctn [15–34] действует через мембранную проницаемость и некроз, как описано для штаммов E.coli и C. albicans [122, 123].

Понимание функциональности структурных доменов SV-CATH было представлено Oliveira-Júnior et al. используя Ctn [15–34] в качестве модели. Как описано выше, SV-CATH содержат анионную область между доменом кателина и зрелым доменом AMP, который обычно не встречается в других CATH. Таким образом, путем включения декапептида Glu на N-конец Ctn [15–34] для создания модели «пропептида» Oliveira-Júnior et al. подтвердили, что этот кислотный фрагмент способствует более спиральной конформации и предотвращает антимикробную активность пептида до его высвобождения [78].

  • Другие CATH, полученные из змей : дополнительные CATH, полученные из гадюки, были предсказаны Falcao et al. Из ядовитой железы Lachesis muta rhombeata (лачесицидин), Bothrops atrox (батроксицидин) и B lutzi (луцицидин), а также два клона из elapid, Pseudonaja textili s (Pt-CATh2 и Pt-CATh3). Батроксицидин и Pt-CATh2 проявляли антибактериальную активность, сравнимую с таковой у Ctn, но были более гемолитическими [84].Более того, батроксицидин индуцировал гибель клеток T. cruzi из-за разрушения мембран и демонстрировал общий провоспалительный профиль [110, 111].

CATH были аналогичным образом предсказаны / идентифицированы в геноме boid, P. bivittatus , оба — Kim et al. и Cai et al. (), обозначенные как Pb-CATh2-5 и CATHPb1-6 соответственно [112,113]. Из набора Pb-CATH, идентифицированных Kim et al., Три (Pb-CATh2, Pb-CATh4 и Pb-CATh5) кодируют зрелые AMP, проявляющие мощную антибактериальную активность против грамотрицательных бактерий (MIC от 0.От 5 до 8 мкг / мл) [113]. Pb-CATh5, например, вызывал гибель бактерий за счет образования тороидальных пор и проявлял низкий гемолиз и цитотоксичность, а также значительную стабильность в сыворотке [113]. Параллельно CATHPb1 проявлял защиту у мышей, инфицированных MRSA и VRSA (устойчивый к ванкомицину S. aureus ), посредством нейтрофил-опосредованного бактериального клиренса и иммуномодуляции с использованием митоген-активированных протеинкиназ (MAPK) и путей NF-κB [112].

Наконец, другой родственный CATH пептид, Hc-CATH (), был идентифицирован в геноме морской змеи Hydrophis cyanocinctus (кольчатая морская змея) [105].В отличие от общего предпочтения CATH, полученных из наземных змей, грамотрицательным бактериям, Hc-CATH проявляет более или менее одинаковую активность против грамотрицательных и грамположительных бактерий в результате мембранной проницаемости [105]. Hc-CATH обладает внутренними структурными преимуществами по сравнению с другими CATH, такими как высокая стабильность в присутствии солей, высокой температуры (≤90 ° C) и сывороточных протеаз, а также низкая токсичность в отношении эукариотических клеток [105]. В недавнем исследовании Carlile et al. продемонстрировали противовоспалительные свойства и снижение бактериальной нагрузки с помощью Hc-CATH in vivo, используя модели восковой моли и мыши внутрибрюшинной и респираторной инфекции, вызванной P.aeruginosa [106].

Дружелюбная сторона змей: может ли змеиный яд лечить рак крови?

Что такое злокачественные гематологические заболевания?

Гематологические злокачественные новообразования — это злокачественные опухоли, которые возникают в кроветворных тканях, таких как костный мозг. Это пятый по распространенности тип рака в Великобритании: каждые 20 минут диагностируется один человек. Примеры включают острый миелоидный лейкоз (AML), острый лимфобластный лейкоз (ALL), множественную миелому, миелопролиферативные новообразования и лимфомы.Из них AML и ALL несут ответственность за большинство случаев, на которые ежегодно приходится около 3000 смертей. Большая часть этих пациентов — это люди в возрасте 80 лет и старше, которые также относятся к группе высокого риска: только 10% отвечают на химиотерапию. К сожалению, другие варианты лечения мало улучшают общую выживаемость и во многих случаях являются более агрессивными и имеют побочные эффекты. Таким образом, сохраняется острая необходимость в разработке более эффективных и лучше переносимых методов лечения ОМЛ и ОЛЛ.

Змеи и змеиный яд

Существует около 3600 видов змей, из которых 600 ядовиты, и только 200 видов представляют значительную угрозу для человека. Змеи встречаются на всех континентах и ​​суше, кроме Антарктиды, Ирландии, Гренландии, Исландии и Новой Зеландии. В Ирландии ходят легенды, что когда-то в стране действительно были змеи, но католический Святой Патрик преследовал ирландских змей в море, изгоняя их.

Змеи отличаются большим разнообразием как по размеру, так и по токсичности их яда.Сильно ядовитые змеи производят яд для защиты от хищников и обездвиживания добычи. Яд выделяется, синтезируется и хранится в ядовитых железах, расположенных по обе стороны головы и защищенных мышечной оболочкой. Змеиный яд токсичен только тогда, когда попадает в кровеносную систему, поэтому змеи должны кусать других животных, вводя их яд. Токсичность змеиного яда можно измерить и выразить с помощью теста LD50 на мышах (летальная доза 50%): чем ниже значение, тем токсичнее змеиный яд.

Змеиный яд в медицине

Интересно, что змеиный яд использовался в лечебных целях на протяжении всей истории, причем первое лекарство на основе яда появилось в Древней Греции в 380 году до нашей эры. Рассказы о различных лечебных средствах на основе «змеиного масла» также были известны в Европе 18-го века и в США 19-го века. «Масло гадюки», полученное в основном из вареных гремучих змей и гадюки с кожурой, стало широко рекомендованным средством для лечения различных кожных заболеваний и ревматизма. Эти средства сегодня в значительной степени подпадают под общий термин «змеиный жир» — псевдоледицинские средства, которые рекламируются как лекарства от всех болезней, несмотря на слабое научное подтверждение их эффективности.

Однако сегодня существует множество одобренных лекарств на основе яда, таких как каптоприл. Разработанный из пептида, содержащегося в яде ботропса jararaca (гадюки), каптоприл представляет собой ингибитор ангиотензинпревращающего фермента, используемый для лечения гипертонии и застойной сердечной недостаточности.

Змеиный яд в настоящее время исследуется как потенциальное средство против отравления. По данным Всемирной организации здравоохранения (ВОЗ), ежегодно происходит около 5,4 миллиона укусов змей, из них 2.Ежегодно регистрируется 3 миллиона случаев отравления. В результате во всем мире погибло около 100 000 человек. Таким образом, змеиные яды интенсивно исследуются и используются для разработки новых, противоэнвеномных методов лечения, часто путем гипериммунизации животных-доноров нелетальными дозами одного или нескольких змеиных ядов.

Хотя змеиный яд является богатым источником природных биоактивных соединений, которые можно использовать для синтеза противоэнвеномной терапии, в настоящее время показано, что многие из этих соединений обладают противораковыми свойствами.

Змеиный яд как противораковое средство

Змеиный яд представляет собой сложную смесь белков, пептидов, ферментов и нуклеотидов. Очистка и характеристика некоторых из этих специфических соединений привели к исследованиям, подчеркивающим способность токсинов и соединений змеиного яда вмешиваться в ключевые процессы онкогенеза, такие как инвазия раковых клеток и метастазирование. Некоторые из наиболее интересных и эффективных соединений с противораковыми свойствами, выявленных на данный момент, включают оксидазу L-аминокислот (LAAO), металлопротеиназы змеиного яда (SVMP), дезинтегрины, лектины C-типа и ферменты фосфолипазы A2 (PLA2).Многие из их механизмов действия на раковые клетки также описаны, некоторые из них перечислены ниже:

  • реактивных кислородных зависимых повреждения ДНК (например, LAAO и PLA2)

  • Блокада передачи сигналов внеклеточного матрикса-интегрина (SVMP, лектины C-типа и дезинтегрины)

  • ингибирование пролиферации, миграции и инвазии раковых клеток (LAAO, PLA2, лектины C-типа, SVMP и дезинтегрины)

  • индукция апоптоза через внешние или внутренние пути (LAAO и PLA2).

Змеиный яд в гематологии — что нам известно?

Было показано, что многие токсины и соединения змеиного яда обладают селективной токсичностью и противораковой активностью в отношении линий раковых клеток груди, шейки матки и других. Исследования in vitro также выявили новые токсины и соединения змеиного яда, эффективные при уничтожении раковых клеток крови. Одним из этих захватывающих соединений является LAAO, выделенный из змеиного яда Micrurus mipartitus, который, как было показано, вызывает морфологические изменения в ядре клеток Т-лимфоцитов (линия клеток Jurkat), также вызывая значительное снижение потенциала митохондриальной мембраны.Исследование показало, что LAAO индуцирует апоптотическую гибель клеток посредством h3O2-опосредованного сигнального пути, также наблюдая повышенную регуляцию гена-супрессора опухоли, p53. Авторы предложили потенциальную разработку соединений M. mipartitus в качестве потенциального лечения T-ALL.

Другой пример нового соединения змеиного яда, идентифицированного как цитотоксичное для клеток рака крови, включает LAOO, очищенный из змеиного яда Calloselasma rhodostoma. Показано, что у него повышенная цитотоксичность в отношении клеточных линий миелопролиферативных новообразований, положительных по мутации JAK2V617F, исследование сравнило цитотоксичность изолированного LAAO с этопозидом, стандартным химиотерапевтическим препаратом.Было показано, что LAAO более эффективно вызывает цитотоксичность на двух клеточных линиях, а позже было показано, что он действует, провоцируя активацию внешнего пути апоптоза в клетках, позитивных по мутации JAKV617F.

LAAO — не единственный компонент змеиного яда, который, как было показано, эффективно взаимодействует с клетками рака крови и убивает их. Бенати и его коллеги использовали новый фермент PLA2, полученный из змеиного яда, выделенный из змеиного яда B. moojeni, чтобы продемонстрировать избирательную цитотоксичность PLA2 в отношении HL-60, клеток промиелоцитарного лейкоза и клеток хронического миелоидного лейкоза (линии клеток K562-S и K562-R. ).Было показано, что фермент MjTX-I цитотоксичен по отношению к лейкемическим раковым клеткам, но не цитотоксичен по отношению к нормальным мононуклеарным клеткам периферической крови. Это подняло вопрос о том, могут ли эти ферменты, полученные из змеиного яда, избирательно воздействовать на раковые клетки. Интересно, что исследования в нашей лабораторной группе с использованием нормальных стволовых клеток костного мозга продемонстрировали избирательную цитотоксичность сырого змеиного яда Crotalus vegrandis в отношении ВСЕХ клеток, аналогично работе Бенати и его коллег. По-видимому, задействован возможный избирательный механизм действия, специфичный для раковых клеток.

Ферменты PLA2 змеиного яда также появились как жизнеспособное соединение, представляющее интерес для лечения рака крови, поскольку они обладают антикоагулянтными свойствами через механизмы, зависящие и независимые от их основной функции гидролиза глицерофосфолипидов. Это имеет много возможных преимуществ для пациентов, особенно в контексте тромбоза, связанного с раком и вызванного химиотерапией, которые являются основными причинами смерти онкологических больных. В настоящее время проводятся исследования для выяснения путей и участков, через которые могут действовать ферменты антикоагулянта PLA2, что может привести к разработке новых терапевтических антикоагулянтов, которые могут использоваться для лечения сердечно-сосудистых заболеваний, но также потенциально могут использоваться в качестве дополнительной терапии у больных раком, которые лечение связанными с тромбозом терапиями, такими как химиотерапия.В конечном счете, есть надежда, что объединение способности ферментов PLA2 вызывать специфическую цитотоксичность раковых клеток с их способностью также индуцировать антикоагуляцию может однажды привести к созданию нового терапевтического средства против рака крови.

Куда дальше?

Открываются новые токсины змеиного яда, которые убивают лейкемические клетки. Одним из примеров является недавно обнаруженный SVMP, Насулизин-1, выделенный из яда змеи Porthidium nasutum и, как было показано, индуцирует апоптоз в лейкемических клеточных линиях (клетки Jurkat и K562) через механизмы, зависящие от каспазы-3 и фактора, индуцирующего апоптоз (AIF).На данный момент характеристика их механизмов действия в клеточных линиях рака крови, а также определение других новых эффективных соединений, по-видимому, является основным направлением исследований. Таким образом, использование змеиного яда в качестве противораковой терапии таких заболеваний, как ОМЛ и ОЛЛ, остается на ранней стадии, но это быстро развивающаяся область, и регулярно публикуются новые статьи. Следующим шагом будет прием Насулина-1 и других компонентов змеиного яда, упомянутых в этой статье, для проведения исследований in vivo с целью дальнейшей проверки их терапевтического потенциала.Поэтому есть надежда, что однажды «каптоприл» появится в качестве будущего средства лечения рака крови.


Если вы являетесь членом Британского фармакологического общества, пожалуйста, войдите, чтобы оставлять комментарии.

Подростки зоопарка Хьюстона спасают змей

Фото: историк Zoo Crew, Хайден

Во Всемирный день змей в зоопарке Хьюстона чествуют змей всех видов и пытаются развеять мифы об этой страшной рептилии. Все лето подростки в зоопарке Хьюстона возглавляют новую кампанию с целью изменить восприятие хьюстонцами одного из самых непонятых животных на планете.Змеи, которых часто называют агрессивными и опасными животными, играют жизненно важную роль в поддержании здоровых экосистем и приносят пользу людям большим количеством способов, чем многие думают. Это недоразумение побудило группу подростков, Комитет кампании по спасению змей, работать над спасением этих животных в дикой природе. Заявление об их назначении выглядит следующим образом:

Цель Кампании по спасению змей — понять, как сообщества воспринимают змей и откуда это восприятие, чтобы способствовать новому толкованию и оценке змей посредством исследований, образования и привлечения опыта.

Змеи, хотя многие считают их угрозой, предоставляют людям множество экологических услуг. Во-первых, змеи являются хищниками и играют решающую роль в поддержании баланса в местных экосистемах. Примечательно, что змеи также являются большим средством естественной борьбы с вредителями, питаясь грызунами и другими мелкими животными, которые считаются неприятностью для людей. Кроме того, как упоминалось в книге «Змеиные яды в терапии рака: прошлое, настоящее и будущее», змеиный яд обладает свойствами, способными бороться с раком, и используется в серии исследовательских испытаний в онкологических центрах по всему миру (Li, Huang, Lin 2018).Помимо той роли, которую змеи играют в поддержании здоровья наших экосистем и проведении медицинских исследований, они являются чрезвычайно уникальными животными, заслуживающими признательности и защиты.

Партнер по охране дикой природы, Мурти Кантимаханти

Зоопарк Хьюстона спасает змей не только в местных сообществах, но и во всем мире. Зоопарк стремится спасти диких собратьев королевской кобры. Мурти Кантимаханти, основатель и директор Общества дикой природы Восточных Гатов, одного из многочисленных партнеров зоопарка по охране дикой природы, работает над защитой змей в Восточных Гатах Индии, спасая и перемещая 15 королевских кобр и более 400 других местных змей от потенциального конфликта с сельскими жителями в только 2020 год.При поддержке и обучении со стороны Хьюстонского зоопарка, Мурти работает со своей командой в Индии, чтобы рассеять страх и изменить стигмы, окружающие змей в своем местном сообществе, и сыграл большую роль в расширении прав и возможностей и вдохновении команды зоопарка Хьюстонского зоопарка на создание своей собственной кампании по спасти змей здесь, в Хьюстоне.

«Программа подросткового зоопарка по защите местных змей Техаса — хорошая инициатива, поскольку она имеет уникальный подход к пониманию и устранению« офидиофобии », боязни змей, среди целевой аудитории, что также является одной из основных причин возникновения человеческого — конфликт змей, — сказал Кантимаханти.

Комитет кампании по спасению змей в настоящее время собирает данные, чтобы понять, как посетители зоопарка воспринимают змей. Они делают это с помощью опросов, интерактивных викторин и мероприятий, а также наблюдений за гостями, в которых члены Zoo Crew записывают данные наблюдений за взаимодействиями гостей со змеиными экспонатами. Отсюда Комитет намеревается начать анализ собранных данных в надежде на более глубокое понимание взглядов хьюстонцев на змей и того, как они в качестве интерпретаторов и защитников природы могут способствовать пониманию змей и обучать сообщество тому, как сосуществовать со змеями.

Весенняя змея ID: Часть II

Эрин Кода

Это вторая часть серии блогов, состоящей из двух частей! Обязательно ознакомьтесь с частью I, чтобы узнать о наиболее распространенных видах змей в Огайо и мифах об их идентификации.

Статистика укусов змеи

Прежде чем я расскажу о трех ядовитых видах змей в Огайо, я хочу уделить время обсуждению опасности укуса змей по сравнению с другими опасностями в нашей жизни. Хотя боязнь змей не всегда рациональна и поэтому не обязательно может быть устранена фактами, я все же думаю, что рассмотрение опасности ядовитых змей в перспективе может быть полезным и интересным упражнением.

Основываясь на данных CDC, собранных с 1999 по 2017 год, в среднем 6 человек умирают в год из-за осложнений, вызванных отравлением змеями, из примерно 8000 зарегистрированных укусов. Из этих 8000 укусов:
  • 66% были результатом прямого преследования , то есть человек пытался схватить змею или убить ее
  • 25% были «сухими» укусами, при которых не произошло отравления
  • 40% были связаны с алкоголем или опьянением
  • 80% укушенных — мужчины или мальчики
Эти 8000 укусов и 6 смертей ежегодно включают людей, которые ежедневно работают с ядовитыми змеями, например специалистов по дикой природе и людей, собирающих яд для фармацевтических исследований; те, кто обращается с ядовитыми змеями как часть своей религиозной веры; частные любители змей; хвастающиеся люди в состоянии алкогольного опьянения; и подражатели Стива Ирвина — а также средний человек, который убивает каждую змею, которую находит у себя во дворе.

Для сравнения, средний американец:
  • В 3,5 раза больше шансов погибнуть в авиакатастрофе
  • В 5,5 раз больше вероятность быть убитым домашней собакой
  • В 7 раз больше вероятность быть пораженным и убитым молнией
  • В 10,5 раз больше шансов быть убитым несанкционированной газонокосилкой («моторизованное оборудование для газонов» — настоящая категория в данных CDC!)
  • В 70 раз больше шансов утонуть в ванне
Кажется, теперь страх, окружающий змей, неуместен?

Три ядовитых вида змей Огайо Три ядовитые змеи в Огайо — это северная медная змея, восточная гремучая змея массасауга и лесная гремучая змея.

Несмотря на то, что вы, возможно, слышали или думали, что видели, на сегодняшний день в Огайо не было обнаружено ни одного ватника / водяных мокасин (хотя по мере потепления климата это почти наверняка изменится). Таким образом, фотографические или вещественные доказательства наличия ватника в Огайо были бы очень важны и имели бы огромную научную ценность для сообщества дикой природы. Если вы думаете, что нашли ватник, сделайте несколько фотографий и заполните форму наблюдения за дикими животными, чтобы отправить свои наблюдения в ODNR, или вы можете связаться с нами.Я также рекомендую использовать приложения для смартфонов iNaturalist или HerpMapper, где другие натуралисты могут подтвердить ваш идентификатор и добавить ваши наблюдения в различные исследовательские проекты.

Две из 3 ядовитых змей Огайо имеют особые требования к среде обитания, и маловероятно, что с ними можно будет случайно встретиться, и всех трех можно легко распознать и избежать.

1. Медвежонок северный (
Agkistrodon contortrix ) Эта змея среднего размера с массивным телом и красивым рисунком, возможно, является самой опасной из змей в нашей части страны, но это опасение необоснованно.Хотя медноголовый медвежонок ответственен за большинство укусов ядовитых змей, о которых ежегодно сообщается в CDC, их яд наименее токсичен из всех ядовитых змей Северной Америки. Смертность от укусов медноголовых незначительна, и для выздоровления редко даже требуется противоядие.

Медвежьи головы питаются разнообразной добычей, от млекопитающих и земноводных до цикад и гусениц включительно. Посмотрите это видео, в котором медвежонок выслеживает и поедает личинку цикады:

Младенцы могут быть более сероватыми или коричневатыми по цвету, но их легко узнать по ярко-желтому или зеленому кончику хвоста, который они используют для привлечения добычи.

Отметины медвежьей головы могут быть разными, но обычно имеют форму песочных часов, причем самая узкая часть проходит вдоль позвоночника. Их отметины и окраска от коричневого до оранжевого помогают им сливаться с лесной подстилкой, где они проводят большую часть своего времени. В отличие от водных змей, за которых их часто принимают, у них бледная верхняя губа, которая видна с довольно большого расстояния (как показано ниже), в то время как водяные змеи имеют решетчатую или темную верхнюю губу.

При встрече медноголовые обычно остаются неподвижными, полагаясь на свой превосходный камуфляж, чтобы избежать обнаружения.Из-за этого многие укусы случаются, когда человек неосознанно наступает на них или случайно хватает их во время работы в саду, что еще больше усиливает страх перед этим видом, поскольку кажется, что укусы «происходят из ниоткуда».

В Огайо медноголовые в настоящее время встречаются только в нескольких округах не покрытого льдом юго-востока Огайо. Интересный факт: фермент в яде медноголового используется для уменьшения опухолей рака молочной железы, а два распространенных лекарства от кровяного давления были получены из яда гадюки Bothrops , имеющей дальнее родство.

2. Восточная Массасауга (
Sistrurus catenatus ) Эта красивая маленькая гремучая змея редко превышает два фута в длину и чрезвычайно редка и сокращается в Огайо из-за потери среды обитания. Этот застенчивый вид часто становится целью незаконного сбора и браконьерства в некоторых наших охраняемых природных заповедниках — последних местах в Огайо, где его все еще можно найти.

Его название — слово чиппева, что означает «устье великой реки», возможно, отсылая к среде обитания, в которой они когда-то были найдены.Сегодня они обитают в плохо осушаемых заболоченных местах, прилегающих к высокогорным прериям, которые также редки и сокращаются в Огайо. Сохранение этого вида является сложной задачей, поскольку на протяжении своего жизненного цикла они зависят от нескольких типов среды обитания. Зимуют в норах раков.

Он не хочет дребезжать, и звук представляет собой сухой высокий гул, который трудно отличить от кузнечиков, с которыми он живет в своей среде обитания. Он почти полностью питается мелкими млекопитающими, хотя иногда они поедают земноводных и других рептилий, особенно в молодости.
3. Гремучая змея деревянная (
Crotalus horridus ) Деревянная гремучая змея — самая тяжелая змея в Огайо, и они могут достигать 4 футов в длину. Эта гремучая змея с массивным телом может быть довольно красивой и имеет характерный узор из темных шевронов или треугольников на фоне от темно-коричневого до золотистого, как у человека ниже. Некоторые виды древесины могут быть почти полностью черными.

Типичный лесоматериал можно найти свернувшимся калачиком рядом с бревнами на лесной подстилке в летние месяцы, ожидая, пока мимо проедет их добыча грызунов.Как и медноголовый, он полагается на камуфляж, чтобы избежать обнаружения, и может не дребезжать при столкновении. Даже если ее потревожить, эта змея с очень мягкими манерами попытается убежать, а не стоять на месте. Я встретил симпатичного человека внизу на грунтовой дороге в сельской местности Пенсильвании, и он никогда не дребезжал — даже когда я убирал его с дороги с помощью треккинговых палок.

В северных частях своего ареала Timbers зимуют в каменистых логовах вдоль высоких хребтов Аппалачей.Самки змей рожают живые существа в конце лета и защищают своих детенышей от хищников в течение первых двух недель их жизни и могут даже «нянчить» детенышей других пород древесины.

Древесина избегает населенных пунктов и чаще всего встречается в лесных средах обитания не покрытого льдом Огайо, а численность населения сокращается из-за потери среды обитания и прямого преследования со стороны людей.

Заключительные мысли и другие ресурсы

Змеи, возможно, являются наиболее злокачественными позвоночными животными в западной культуре. Когда вы в последний раз читали рассказ или смотрели фильм со змеей в нем, и змея была изображена как злодей , а не ? Ознакомьтесь с этим списком появления змей в фильмах.Какая часть этих фильмов изображает змею благоприятно или даже нейтрально? От Змея в Библии до Каа из Книги Джунглей и Нагини в Гарри Поттере, кажется, мы любим ненавидеть змей. Это почему?

Если вы боитесь змей или ненавидите их, подумайте, почему это может быть. Возможно, у вас был родитель, дедушка или бабушка или близкий друг семьи, которые настаивали на убийстве змей на своей территории. Возможно, ваш брат, сестра или друг ловили их и пугали вас ими.Или, возможно, они просто «неприятны» для вас, и вы не знаете почему.

Какой бы ни была причина, небольшое образование помогает развеять эти страхи и жуткие чувства. Если вы находитесь на Facebook, я призываю вас присоединиться к группе идентификации змей.

Leave a Reply

Ваш адрес email не будет опубликован.